BLASTX nr result
ID: Coptis25_contig00014028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00014028 (524 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACF06616.1| Toc34-2 protein [Elaeis guineensis] 86 3e-15 gb|AAM65983.1| GTP-binding protein [Arabidopsis thaliana] 80 2e-13 ref|NP_196119.1| translocase of chloroplast 34 [Arabidopsis thal... 80 2e-13 ref|XP_002873181.1| ATTOC34/OEP34 [Arabidopsis lyrata subsp. lyr... 80 2e-13 dbj|BAH20396.1| AT5G05000 [Arabidopsis thaliana] 80 2e-13 >gb|ACF06616.1| Toc34-2 protein [Elaeis guineensis] Length = 312 Score = 86.3 bits (212), Expect = 3e-15 Identities = 41/55 (74%), Positives = 44/55 (80%) Frame = +3 Query: 3 GPNPNERHKFLIPLILAFQYFFIVKPIQRAIKHDIFKESKPSWELRDVGQAGRRF 167 GPNPN R K IPL+LAFQ FF VKPIQ+AIKHD+ KESKP WELRDVG A R F Sbjct: 258 GPNPNARGKLFIPLLLAFQDFFRVKPIQKAIKHDMAKESKPLWELRDVGLANRNF 312 >gb|AAM65983.1| GTP-binding protein [Arabidopsis thaliana] Length = 313 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/54 (66%), Positives = 43/54 (79%) Frame = +3 Query: 3 GPNPNERHKFLIPLILAFQYFFIVKPIQRAIKHDIFKESKPSWELRDVGQAGRR 164 GPNPNER K LIPL+ AFQY ++KP+ RAIK D+ +ESKP+WELRD G A RR Sbjct: 259 GPNPNERGKKLIPLMFAFQYLLVMKPLVRAIKSDVSRESKPAWELRDSGLASRR 312 >ref|NP_196119.1| translocase of chloroplast 34 [Arabidopsis thaliana] gi|30680751|ref|NP_850768.1| translocase of chloroplast 34 [Arabidopsis thaliana] gi|42573271|ref|NP_974732.1| translocase of chloroplast 34 [Arabidopsis thaliana] gi|166897637|sp|Q38906.2|TOC34_ARATH RecName: Full=Translocase of chloroplast 34, chloroplastic; Short=AtToc34; AltName: Full=34 kDa chloroplast outer envelope protein; AltName: Full=GTP-binding protein OEP34; AltName: Full=Plastid protein import 3 gi|10178039|dbj|BAB11522.1| GTP-binding protein [Arabidopsis thaliana] gi|110738722|dbj|BAF01285.1| GTP-binding protein [Arabidopsis thaliana] gi|199589346|gb|ACH90464.1| At5g05000 [Arabidopsis thaliana] gi|332003431|gb|AED90814.1| translocase of chloroplast 34 [Arabidopsis thaliana] gi|332003432|gb|AED90815.1| translocase of chloroplast 34 [Arabidopsis thaliana] gi|332003433|gb|AED90816.1| translocase of chloroplast 34 [Arabidopsis thaliana] Length = 313 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/54 (66%), Positives = 43/54 (79%) Frame = +3 Query: 3 GPNPNERHKFLIPLILAFQYFFIVKPIQRAIKHDIFKESKPSWELRDVGQAGRR 164 GPNPNER K LIPL+ AFQY ++KP+ RAIK D+ +ESKP+WELRD G A RR Sbjct: 259 GPNPNERGKKLIPLMFAFQYLLVMKPLVRAIKSDVSRESKPAWELRDSGLASRR 312 >ref|XP_002873181.1| ATTOC34/OEP34 [Arabidopsis lyrata subsp. lyrata] gi|297319018|gb|EFH49440.1| ATTOC34/OEP34 [Arabidopsis lyrata subsp. lyrata] Length = 313 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/54 (66%), Positives = 43/54 (79%) Frame = +3 Query: 3 GPNPNERHKFLIPLILAFQYFFIVKPIQRAIKHDIFKESKPSWELRDVGQAGRR 164 GPNPN+R K LIPLI AFQY ++KP+ RAIK D+ +ESKP+WELRD G A RR Sbjct: 259 GPNPNQRGKRLIPLIFAFQYLLVMKPLVRAIKSDVTRESKPAWELRDSGLASRR 312 >dbj|BAH20396.1| AT5G05000 [Arabidopsis thaliana] Length = 246 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/54 (66%), Positives = 43/54 (79%) Frame = +3 Query: 3 GPNPNERHKFLIPLILAFQYFFIVKPIQRAIKHDIFKESKPSWELRDVGQAGRR 164 GPNPNER K LIPL+ AFQY ++KP+ RAIK D+ +ESKP+WELRD G A RR Sbjct: 192 GPNPNERGKKLIPLMFAFQYLLVMKPLVRAIKSDVSRESKPAWELRDSGLASRR 245