BLASTX nr result
ID: Coptis25_contig00014004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00014004 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139289.1| PREDICTED: synaptotagmin-5-like [Cucumis sat... 55 6e-06 >ref|XP_004139289.1| PREDICTED: synaptotagmin-5-like [Cucumis sativus] gi|449517890|ref|XP_004165977.1| PREDICTED: synaptotagmin-5-like [Cucumis sativus] Length = 567 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 221 ENTRSKKRTDLAAAIAAFARMTVEDSRKLLP 313 EN RSK+R DLAA IAAFARMTVEDSRKLLP Sbjct: 25 ENARSKRRADLAATIAAFARMTVEDSRKLLP 55