BLASTX nr result
ID: Coptis25_contig00013827
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00013827 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003609377.1| WD repeat-containing protein [Medicago trunc... 64 2e-08 ref|XP_002527178.1| WD-repeat protein, putative [Ricinus communi... 61 8e-08 ref|XP_003541476.1| PREDICTED: topless-related protein 4-like [G... 59 3e-07 ref|XP_003633080.1| PREDICTED: topless-related protein 4-like [V... 58 7e-07 ref|XP_002285341.2| PREDICTED: topless-related protein 4-like is... 58 7e-07 >ref|XP_003609377.1| WD repeat-containing protein [Medicago truncatula] gi|355510432|gb|AES91574.1| WD repeat-containing protein [Medicago truncatula] Length = 1132 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -2 Query: 291 MLKRPRTPTNNPSMDYHTADSKLLMKRTRPLGISDDVLCNPV 166 +LKRPRTP NNP+MDY TADS +MKRTRP GISD+V PV Sbjct: 280 LLKRPRTPPNNPAMDYQTADSDHVMKRTRPFGISDEVNNLPV 321 >ref|XP_002527178.1| WD-repeat protein, putative [Ricinus communis] gi|223533443|gb|EEF35191.1| WD-repeat protein, putative [Ricinus communis] Length = 1134 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/43 (69%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -2 Query: 291 MLKRPRTP-TNNPSMDYHTADSKLLMKRTRPLGISDDVLCNPV 166 ++KRPRTP TNNPSMDY TADS+ ++KRTRP GISD+V PV Sbjct: 280 IIKRPRTPPTNNPSMDYQTADSENVLKRTRPFGISDEVSNLPV 322 >ref|XP_003541476.1| PREDICTED: topless-related protein 4-like [Glycine max] Length = 1232 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -2 Query: 291 MLKRPRTP-TNNPSMDYHTADSKLLMKRTRPLGISDDVLCNPV 166 +LKRPRTP TNNP+MDY TADS ++KRTRP G+SD+V PV Sbjct: 380 ILKRPRTPPTNNPAMDYQTADSDHVLKRTRPFGLSDEVSNLPV 422 >ref|XP_003633080.1| PREDICTED: topless-related protein 4-like [Vitis vinifera] Length = 1123 Score = 58.2 bits (139), Expect = 7e-07 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -2 Query: 291 MLKRPRTP-TNNPSMDYHTADSKLLMKRTRPLGISDDVLCNPV 166 +LKRPRTP TNNP+MDY TADS+ ++KR RP GISD+V PV Sbjct: 281 ILKRPRTPPTNNPAMDYQTADSEHVLKRPRPFGISDEVNNLPV 323 >ref|XP_002285341.2| PREDICTED: topless-related protein 4-like isoform 1 [Vitis vinifera] gi|297738983|emb|CBI28228.3| unnamed protein product [Vitis vinifera] Length = 1133 Score = 58.2 bits (139), Expect = 7e-07 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -2 Query: 291 MLKRPRTP-TNNPSMDYHTADSKLLMKRTRPLGISDDVLCNPV 166 +LKRPRTP TNNP+MDY TADS+ ++KR RP GISD+V PV Sbjct: 281 ILKRPRTPPTNNPAMDYQTADSEHVLKRPRPFGISDEVNNLPV 323