BLASTX nr result
ID: Coptis25_contig00013075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00013075 (522 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004159267.1| PREDICTED: exocyst complex component 7-like ... 69 5e-10 ref|XP_004159234.1| PREDICTED: exocyst complex component 7-like ... 69 5e-10 ref|XP_003632655.1| PREDICTED: exocyst complex component 7 isofo... 69 5e-10 ref|XP_002864165.1| predicted protein [Arabidopsis lyrata subsp.... 69 5e-10 ref|XP_002532543.1| protein binding protein, putative [Ricinus c... 69 5e-10 >ref|XP_004159267.1| PREDICTED: exocyst complex component 7-like [Cucumis sativus] Length = 190 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 247 RSEAKDLLGDDWVHIHRRTMQQHANQYKRVSWGK 348 RSEAKDLLGDDWV IHRR +QQHANQYKR+SW K Sbjct: 38 RSEAKDLLGDDWVQIHRRVVQQHANQYKRISWAK 71 >ref|XP_004159234.1| PREDICTED: exocyst complex component 7-like [Cucumis sativus] Length = 628 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 247 RSEAKDLLGDDWVHIHRRTMQQHANQYKRVSWGK 348 RSEAKDLLGDDWV IHRR +QQHANQYKR+SW K Sbjct: 487 RSEAKDLLGDDWVQIHRRVVQQHANQYKRISWAK 520 >ref|XP_003632655.1| PREDICTED: exocyst complex component 7 isoform 2 [Vitis vinifera] Length = 640 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 247 RSEAKDLLGDDWVHIHRRTMQQHANQYKRVSWGK 348 RSEAKDLLGDDWV IHRR +QQHANQYKRVSW K Sbjct: 492 RSEAKDLLGDDWVQIHRRIVQQHANQYKRVSWAK 525 >ref|XP_002864165.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297310000|gb|EFH40424.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 631 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 247 RSEAKDLLGDDWVHIHRRTMQQHANQYKRVSWGK 348 RSEAKDLLGDDWV IHRR +QQHANQYKRVSW K Sbjct: 483 RSEAKDLLGDDWVQIHRRIVQQHANQYKRVSWAK 516 >ref|XP_002532543.1| protein binding protein, putative [Ricinus communis] gi|223527732|gb|EEF29837.1| protein binding protein, putative [Ricinus communis] Length = 638 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 247 RSEAKDLLGDDWVHIHRRTMQQHANQYKRVSWGK 348 RSEAKDLLGDDWV IHRR +QQHANQYKRVSW K Sbjct: 490 RSEAKDLLGDDWVQIHRRIVQQHANQYKRVSWAK 523