BLASTX nr result
ID: Coptis25_contig00013073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00013073 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004165255.1| PREDICTED: protein notum homolog, partial [C... 75 7e-12 ref|XP_004142204.1| PREDICTED: protein notum homolog [Cucumis sa... 75 7e-12 ref|XP_002264809.2| PREDICTED: protein notum homolog [Vitis vini... 72 5e-11 emb|CBI30560.3| unnamed protein product [Vitis vinifera] 72 5e-11 ref|XP_003623071.1| Notum-like protein [Medicago truncatula] gi|... 71 1e-10 >ref|XP_004165255.1| PREDICTED: protein notum homolog, partial [Cucumis sativus] Length = 430 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +3 Query: 165 NPPLGKLSLLRNAKSLGAVCLDGSPPGYHFRKGFGSGSRNWLLHIE 302 +P L L+LL+NAK+ GA+CLDGS PGYHF+KGFGSGS NW+LHIE Sbjct: 59 DPDLVDLTLLQNAKAKGALCLDGSLPGYHFQKGFGSGSSNWVLHIE 104 >ref|XP_004142204.1| PREDICTED: protein notum homolog [Cucumis sativus] Length = 469 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +3 Query: 165 NPPLGKLSLLRNAKSLGAVCLDGSPPGYHFRKGFGSGSRNWLLHIE 302 +P L L+LL+NAK+ GA+CLDGS PGYHF+KGFGSGS NW+LHIE Sbjct: 59 DPDLVDLTLLQNAKAKGALCLDGSLPGYHFQKGFGSGSSNWVLHIE 104 >ref|XP_002264809.2| PREDICTED: protein notum homolog [Vitis vinifera] Length = 393 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 183 LSLLRNAKSLGAVCLDGSPPGYHFRKGFGSGSRNWLLHIE 302 L+L+R+AK GAVCLDGS PGYHFR GFGSGS NW+LHIE Sbjct: 50 LTLVRHAKDKGAVCLDGSAPGYHFRSGFGSGSNNWVLHIE 89 >emb|CBI30560.3| unnamed protein product [Vitis vinifera] Length = 414 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 183 LSLLRNAKSLGAVCLDGSPPGYHFRKGFGSGSRNWLLHIE 302 L+L+R+AK GAVCLDGS PGYHFR GFGSGS NW+LHIE Sbjct: 50 LTLVRHAKDKGAVCLDGSAPGYHFRSGFGSGSNNWVLHIE 89 >ref|XP_003623071.1| Notum-like protein [Medicago truncatula] gi|355498086|gb|AES79289.1| Notum-like protein [Medicago truncatula] Length = 417 Score = 70.9 bits (172), Expect = 1e-10 Identities = 40/89 (44%), Positives = 48/89 (53%) Frame = +3 Query: 36 RGVIWLRKLGNKDYXXXXXXXXXXXXXXTTFDSSSPPIQSTTPNPPLGKLSLLRNAKSLG 215 R VI L K +K TF + S S + L + L N K LG Sbjct: 10 RNVIILLKKWSKQEYTIAAFTIILFIFSLTFLNRSNQSHSNDSHINLIPFTPLANFKQLG 69 Query: 216 AVCLDGSPPGYHFRKGFGSGSRNWLLHIE 302 A+CLDG+ PGYHF+KGFGSGSRNWLLH+E Sbjct: 70 ALCLDGTAPGYHFQKGFGSGSRNWLLHLE 98