BLASTX nr result
ID: Coptis25_contig00013066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00013066 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN81874.1| hypothetical protein VITISV_038366 [Vitis vinifera] 63 1e-15 ref|XP_002281426.1| PREDICTED: eukaryotic translation initiation... 63 1e-15 emb|CBI29961.3| unnamed protein product [Vitis vinifera] 63 1e-15 ref|XP_002323353.1| predicted protein [Populus trichocarpa] gi|2... 60 3e-14 gb|AAL13083.1| putative translation-initiation factor 3 subunit ... 60 7e-14 >emb|CAN81874.1| hypothetical protein VITISV_038366 [Vitis vinifera] Length = 1047 Score = 62.8 bits (151), Expect(3) = 1e-15 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = -3 Query: 135 KGKSISKTFHKLLEESQRLTFTSSPENVFDCIMAASRALSKGDFQ 1 K K ISKTF +LLE S+R TFT PENV D +MAA+RALSKGDFQ Sbjct: 657 KRKVISKTFRRLLEVSERQTFTGPPENVRDHVMAATRALSKGDFQ 701 Score = 42.4 bits (98), Expect(3) = 1e-15 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = -2 Query: 211 LLDAVHLICAMLLEVLNMAVKTGDAEGKV 125 LL+ VHLICAMLLEV NMA T DA+ KV Sbjct: 632 LLEGVHLICAMLLEVPNMAANTHDAKRKV 660 Score = 21.9 bits (45), Expect(3) = 1e-15 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 233 QMPYHMH 213 QMPYHMH Sbjct: 621 QMPYHMH 627 >ref|XP_002281426.1| PREDICTED: eukaryotic translation initiation factor 3 subunit C-like [Vitis vinifera] Length = 946 Score = 62.8 bits (151), Expect(3) = 1e-15 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = -3 Query: 135 KGKSISKTFHKLLEESQRLTFTSSPENVFDCIMAASRALSKGDFQ 1 K K ISKTF +LLE S+R TFT PENV D +MAA+RALSKGDFQ Sbjct: 658 KRKVISKTFRRLLEVSERQTFTGPPENVRDHVMAATRALSKGDFQ 702 Score = 42.4 bits (98), Expect(3) = 1e-15 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = -2 Query: 211 LLDAVHLICAMLLEVLNMAVKTGDAEGKV 125 LL+ VHLICAMLLEV NMA T DA+ KV Sbjct: 633 LLEGVHLICAMLLEVPNMAANTHDAKRKV 661 Score = 21.9 bits (45), Expect(3) = 1e-15 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 233 QMPYHMH 213 QMPYHMH Sbjct: 622 QMPYHMH 628 >emb|CBI29961.3| unnamed protein product [Vitis vinifera] Length = 839 Score = 62.8 bits (151), Expect(3) = 1e-15 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = -3 Query: 135 KGKSISKTFHKLLEESQRLTFTSSPENVFDCIMAASRALSKGDFQ 1 K K ISKTF +LLE S+R TFT PENV D +MAA+RALSKGDFQ Sbjct: 578 KRKVISKTFRRLLEVSERQTFTGPPENVRDHVMAATRALSKGDFQ 622 Score = 42.4 bits (98), Expect(3) = 1e-15 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = -2 Query: 211 LLDAVHLICAMLLEVLNMAVKTGDAEGKV 125 LL+ VHLICAMLLEV NMA T DA+ KV Sbjct: 553 LLEGVHLICAMLLEVPNMAANTHDAKRKV 581 Score = 21.9 bits (45), Expect(3) = 1e-15 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 233 QMPYHMH 213 QMPYHMH Sbjct: 542 QMPYHMH 548 >ref|XP_002323353.1| predicted protein [Populus trichocarpa] gi|222867983|gb|EEF05114.1| predicted protein [Populus trichocarpa] Length = 895 Score = 60.5 bits (145), Expect(3) = 3e-14 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -3 Query: 135 KGKSISKTFHKLLEESQRLTFTSSPENVFDCIMAASRALSKGDFQ 1 K K ISKTF +LLE ++R TFT PENV D +MAA+RAL+KGDFQ Sbjct: 630 KRKVISKTFRRLLEVTERQTFTGPPENVRDHVMAATRALTKGDFQ 674 Score = 40.0 bits (92), Expect(3) = 3e-14 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -2 Query: 211 LLDAVHLICAMLLEVLNMAVKTGDAEGKV 125 LL++VHLICAMLLEV NMA DA+ KV Sbjct: 605 LLESVHLICAMLLEVPNMAANIYDAKRKV 633 Score = 21.9 bits (45), Expect(3) = 3e-14 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 233 QMPYHMH 213 QMPYHMH Sbjct: 594 QMPYHMH 600 >gb|AAL13083.1| putative translation-initiation factor 3 subunit [Prunus avium] Length = 934 Score = 60.1 bits (144), Expect(3) = 7e-14 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -3 Query: 135 KGKSISKTFHKLLEESQRLTFTSSPENVFDCIMAASRALSKGDFQ 1 K + ISKTF +LLE S++ TFT PENV D +MAASRAL KGDFQ Sbjct: 648 KRRLISKTFRRLLEVSEKQTFTGPPENVRDHVMAASRALGKGDFQ 692 Score = 39.3 bits (90), Expect(3) = 7e-14 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = -2 Query: 211 LLDAVHLICAMLLEVLNMAVKTGDAEGKV 125 LL+AVHLICAMLLEV NMA DA+ ++ Sbjct: 623 LLEAVHLICAMLLEVPNMAANIHDAKRRL 651 Score = 21.9 bits (45), Expect(3) = 7e-14 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 233 QMPYHMH 213 QMPYHMH Sbjct: 612 QMPYHMH 618