BLASTX nr result
ID: Coptis25_contig00013008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00013008 (421 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004149628.1| PREDICTED: LRR receptor-like serine/threonin... 44 1e-09 >ref|XP_004149628.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERL1-like [Cucumis sativus] gi|449519276|ref|XP_004166661.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERL1-like [Cucumis sativus] Length = 950 Score = 43.9 bits (102), Expect(2) = 1e-09 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = -2 Query: 282 DLAHNMLSGDIPRLIYWNEVL*YL*V**NF 193 DLA N L+G+IPRLIYWNEVL YL + NF Sbjct: 140 DLARNQLTGEIPRLIYWNEVLQYLGLRGNF 169 Score = 43.5 bits (101), Expect(2) = 1e-09 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -3 Query: 71 GLRENNLTGTLSHDMCQLTGLWY 3 GLR N LTG+LS DMCQLTGLWY Sbjct: 164 GLRGNFLTGSLSSDMCQLTGLWY 186