BLASTX nr result
ID: Coptis25_contig00012862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00012862 (944 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597983.1| Pentatricopeptide repeat-containing protein ... 65 2e-08 ref|XP_002447206.1| hypothetical protein SORBIDRAFT_06g030430 [S... 64 5e-08 ref|XP_002274114.2| PREDICTED: pentatricopeptide repeat-containi... 64 7e-08 ref|XP_002274044.2| PREDICTED: pentatricopeptide repeat-containi... 64 7e-08 emb|CBI29169.3| unnamed protein product [Vitis vinifera] 64 7e-08 >ref|XP_003597983.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355487031|gb|AES68234.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 520 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 942 DALIQKNMVDMARKYDEEMLVKGLSAKPRKELGTKP 835 DAL++K ++DMARKYDEEML KGLS KPRKELGTKP Sbjct: 444 DALVEKGLIDMARKYDEEMLAKGLSPKPRKELGTKP 479 >ref|XP_002447206.1| hypothetical protein SORBIDRAFT_06g030430 [Sorghum bicolor] gi|241938389|gb|EES11534.1| hypothetical protein SORBIDRAFT_06g030430 [Sorghum bicolor] Length = 446 Score = 63.9 bits (154), Expect = 5e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 942 DALIQKNMVDMARKYDEEMLVKGLSAKPRKELGTK 838 DAL+QK MVD+ARKYDEEML KGLS KPRKELGTK Sbjct: 396 DALLQKGMVDLARKYDEEMLAKGLSPKPRKELGTK 430 >ref|XP_002274114.2| PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial-like [Vitis vinifera] Length = 571 Score = 63.5 bits (153), Expect = 7e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 942 DALIQKNMVDMARKYDEEMLVKGLSAKPRKELGTKP 835 DAL+QK MVD+ARKY+EEML KGLSAKPR +LGTKP Sbjct: 533 DALVQKGMVDLARKYEEEMLAKGLSAKPRVDLGTKP 568 >ref|XP_002274044.2| PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial-like [Vitis vinifera] Length = 390 Score = 63.5 bits (153), Expect = 7e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 942 DALIQKNMVDMARKYDEEMLVKGLSAKPRKELGTKP 835 DAL+QK MVD+ARKY+EEML KGLSAKPR +LGTKP Sbjct: 352 DALVQKGMVDLARKYEEEMLAKGLSAKPRVDLGTKP 387 >emb|CBI29169.3| unnamed protein product [Vitis vinifera] Length = 234 Score = 63.5 bits (153), Expect = 7e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 942 DALIQKNMVDMARKYDEEMLVKGLSAKPRKELGTKP 835 DAL+QK MVD+ARKY+EEML KGLSAKPR +LGTKP Sbjct: 196 DALVQKGMVDLARKYEEEMLAKGLSAKPRVDLGTKP 231