BLASTX nr result
ID: Coptis25_contig00012513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00012513 (365 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI33705.3| unnamed protein product [Vitis vinifera] 70 2e-10 ref|XP_002284329.1| PREDICTED: UPF0553 protein [Vitis vinifera] ... 70 2e-10 ref|XP_004141874.1| PREDICTED: UPF0553 protein-like [Cucumis sat... 65 4e-09 gb|AFK37363.1| unknown [Medicago truncatula] 61 8e-08 ref|XP_003611612.1| hypothetical protein MTR_5g015840 [Medicago ... 61 8e-08 >emb|CBI33705.3| unnamed protein product [Vitis vinifera] Length = 306 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 365 QVLSVELDLWLWSFGIQCQSLQHHRTLSIYY 273 QVLSVELDLWLWSFGIQCQSLQHHRTLSIYY Sbjct: 276 QVLSVELDLWLWSFGIQCQSLQHHRTLSIYY 306 >ref|XP_002284329.1| PREDICTED: UPF0553 protein [Vitis vinifera] gi|147768860|emb|CAN78136.1| hypothetical protein VITISV_034055 [Vitis vinifera] Length = 309 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 365 QVLSVELDLWLWSFGIQCQSLQHHRTLSIYY 273 QVLSVELDLWLWSFGIQCQSLQHHRTLSIYY Sbjct: 279 QVLSVELDLWLWSFGIQCQSLQHHRTLSIYY 309 >ref|XP_004141874.1| PREDICTED: UPF0553 protein-like [Cucumis sativus] gi|449519100|ref|XP_004166573.1| PREDICTED: UPF0553 protein-like [Cucumis sativus] Length = 94 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 365 QVLSVELDLWLWSFGIQCQSLQHHRTLSIYY 273 QVLSVELDLWLWSFGIQC SL HHRTLSIYY Sbjct: 64 QVLSVELDLWLWSFGIQCPSLTHHRTLSIYY 94 >gb|AFK37363.1| unknown [Medicago truncatula] Length = 305 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 362 VLSVELDLWLWSFGIQCQSLQHHRTLSIYY 273 VLSVELDLWLW+ GIQC+SL+HHRTLSIYY Sbjct: 276 VLSVELDLWLWATGIQCESLKHHRTLSIYY 305 >ref|XP_003611612.1| hypothetical protein MTR_5g015840 [Medicago truncatula] gi|355512947|gb|AES94570.1| hypothetical protein MTR_5g015840 [Medicago truncatula] Length = 305 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 362 VLSVELDLWLWSFGIQCQSLQHHRTLSIYY 273 VLSVELDLWLW+ GIQC+SL+HHRTLSIYY Sbjct: 276 VLSVELDLWLWATGIQCESLKHHRTLSIYY 305