BLASTX nr result
ID: Coptis25_contig00012494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00012494 (802 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516820.1| 80 kD MCM3-associated protein, putative [Ric... 60 6e-07 >ref|XP_002516820.1| 80 kD MCM3-associated protein, putative [Ricinus communis] gi|223543908|gb|EEF45434.1| 80 kD MCM3-associated protein, putative [Ricinus communis] Length = 1646 Score = 60.1 bits (144), Expect = 6e-07 Identities = 36/96 (37%), Positives = 45/96 (46%) Frame = -3 Query: 296 ARRWPTEPSTFQAPKRTRSPPSPSANETIWKRSHSSQGDTDRDEASPPRLGNSSNLLGSN 117 AR E + APK+T P ANE + K +H Q D+ R SPPRLG SN S Sbjct: 273 ARNSQNEVADVNAPKQTGPLPISPANEVLQKNTHFLQNDSRRPSTSPPRLGPRSNARFSK 332 Query: 116 ATSTVPQRSSLFSPHNMTEGAGLKTLNSQVPKRNRS 9 +PQR+ + E A +T N KR RS Sbjct: 333 YDYQIPQRTFSSDNDTVVEAAQTRTTNYSAAKRTRS 368