BLASTX nr result
ID: Coptis25_contig00012487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00012487 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADK70231.1| chloroplast iron superoxide dismutase, partial [D... 86 3e-15 gb|ADG26763.1| chloroplast iron superoxide dismutase [Dimocarpus... 86 3e-15 emb|CBI28995.3| unnamed protein product [Vitis vinifera] 84 1e-14 ref|XP_002267399.1| PREDICTED: superoxide dismutase [Fe], chloro... 84 1e-14 gb|ABR24273.1| iron-containing superoxide dismutase [Brassica na... 84 1e-14 >gb|ADK70231.1| chloroplast iron superoxide dismutase, partial [Dimocarpus longan] Length = 250 Score = 85.9 bits (211), Expect = 3e-15 Identities = 38/48 (79%), Positives = 45/48 (93%) Frame = -1 Query: 204 AYHVDYKNDKGKYVNVFMNNLVSWHAATTRMARAESFVNLGEPNIPVA 61 AY++DY NDK KYVNVFMN+LVSW+AA +RMARAE+FVNLGEPNIP+A Sbjct: 203 AYYLDYNNDKAKYVNVFMNHLVSWNAAMSRMARAEAFVNLGEPNIPIA 250 >gb|ADG26763.1| chloroplast iron superoxide dismutase [Dimocarpus longan] Length = 202 Score = 85.9 bits (211), Expect = 3e-15 Identities = 38/48 (79%), Positives = 45/48 (93%) Frame = -1 Query: 204 AYHVDYKNDKGKYVNVFMNNLVSWHAATTRMARAESFVNLGEPNIPVA 61 AY++DY NDK KYVNVFMN+LVSW+AA +RMARAE+FVNLGEPNIP+A Sbjct: 155 AYYLDYNNDKAKYVNVFMNHLVSWNAAMSRMARAEAFVNLGEPNIPIA 202 >emb|CBI28995.3| unnamed protein product [Vitis vinifera] Length = 321 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -1 Query: 204 AYHVDYKNDKGKYVNVFMNNLVSWHAATTRMARAESFVNLGEPNIPVA 61 AY++DYKNDKGKY VFMN+LVSW+AA RMARAE+FVNLGEP IP+A Sbjct: 274 AYYLDYKNDKGKYATVFMNHLVSWNAAAARMARAEAFVNLGEPKIPIA 321 >ref|XP_002267399.1| PREDICTED: superoxide dismutase [Fe], chloroplastic [Vitis vinifera] Length = 264 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -1 Query: 204 AYHVDYKNDKGKYVNVFMNNLVSWHAATTRMARAESFVNLGEPNIPVA 61 AY++DYKNDKGKY VFMN+LVSW+AA RMARAE+FVNLGEP IP+A Sbjct: 217 AYYLDYKNDKGKYATVFMNHLVSWNAAAARMARAEAFVNLGEPKIPIA 264 >gb|ABR24273.1| iron-containing superoxide dismutase [Brassica napus] Length = 263 Score = 84.0 bits (206), Expect = 1e-14 Identities = 34/48 (70%), Positives = 46/48 (95%) Frame = -1 Query: 204 AYHVDYKNDKGKYVNVFMNNLVSWHAATTRMARAESFVNLGEPNIPVA 61 +Y++DYKN++GKY+N F+N+LVSW+AA +RMARAE+FVNLGEPNIP+A Sbjct: 216 SYYIDYKNERGKYINTFLNHLVSWNAAMSRMARAEAFVNLGEPNIPIA 263