BLASTX nr result
ID: Coptis25_contig00012373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00012373 (867 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_850466.2| uncharacterized protein [Arabidopsis thaliana] ... 58 3e-06 >ref|NP_850466.2| uncharacterized protein [Arabidopsis thaliana] gi|110736851|dbj|BAF00383.1| hypothetical protein [Arabidopsis thaliana] gi|330255687|gb|AEC10781.1| uncharacterized protein [Arabidopsis thaliana] Length = 793 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/55 (50%), Positives = 39/55 (70%) Frame = +1 Query: 538 SLLLSETSHQKLLAQAEKEIETQLNDADRRITAIRKVARKNMFQLKHVVSECLKE 702 S+ TSHQKL+A E IET+L+DA +RI ++ K AR M QLK +V+ECL++ Sbjct: 738 SIKKQRTSHQKLIAHFEGGIETKLDDATKRIDSVNKSARGKMLQLKMIVAECLRD 792