BLASTX nr result
ID: Coptis25_contig00012233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00012233 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003629220.1| hypothetical protein MTR_8g074720 [Medicago ... 62 6e-08 ref|NP_001237163.1| uncharacterized protein LOC100527004 [Glycin... 60 1e-07 ref|XP_002327717.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|XP_004134836.1| PREDICTED: UPF0548 protein At2g17695-like [C... 57 1e-06 gb|AFX67009.1| hypothetical protein [Solanum tuberosum] 57 2e-06 >ref|XP_003629220.1| hypothetical protein MTR_8g074720 [Medicago truncatula] gi|355523242|gb|AET03696.1| hypothetical protein MTR_8g074720 [Medicago truncatula] Length = 232 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/47 (59%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = +2 Query: 71 HRQN-KLV*KMVFLCWKRPSELDQKACINKCGTFNYDSKYRAATSKS 208 HRQN ++ +MVFL W RP+ DQK CINK GT NYD KY+ A++KS Sbjct: 14 HRQNYNIIVRMVFLSWVRPTAQDQKNCINKSGTLNYDDKYKGASAKS 60 >ref|NP_001237163.1| uncharacterized protein LOC100527004 [Glycine max] gi|255631350|gb|ACU16042.1| unknown [Glycine max] Length = 207 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +2 Query: 98 MVFLCWKRPSELDQKACINKCGTFNYDSKYRAATSKS 208 M+FL W RPS DQK CINK GTFNYD KY+ AT+KS Sbjct: 1 MLFLSWGRPSPQDQKTCINKSGTFNYDDKYKGATAKS 37 >ref|XP_002327717.1| predicted protein [Populus trichocarpa] gi|222836802|gb|EEE75195.1| predicted protein [Populus trichocarpa] Length = 202 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +2 Query: 98 MVFLCWKRPSELDQKACINKCGTFNYDSKYRAATSK 205 MVFLCW +PS +QK C+NK FNYDSKYR ATSK Sbjct: 1 MVFLCWAKPSLQEQKDCLNKSDGFNYDSKYRGATSK 36 >ref|XP_004134836.1| PREDICTED: UPF0548 protein At2g17695-like [Cucumis sativus] gi|449491283|ref|XP_004158849.1| PREDICTED: UPF0548 protein At2g17695-like [Cucumis sativus] Length = 208 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +2 Query: 98 MVFLCWKRPSELDQKACINKCGTFNYDSKYRAATS 202 MVFLCW RPS +QKACI + G+FNY+SK+R AT+ Sbjct: 1 MVFLCWSRPSPQEQKACIERAGSFNYNSKFRGATA 35 >gb|AFX67009.1| hypothetical protein [Solanum tuberosum] Length = 203 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +2 Query: 98 MVFLCWKRPSELDQKACINKCGTFNYDSKYRAATSK 205 MVFL W RPS +QKACINK G+FNYD+++R AT K Sbjct: 1 MVFLSWTRPSPDEQKACINKSGSFNYDNRFRGATDK 36