BLASTX nr result
ID: Coptis25_contig00011861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00011861 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA53431.1| TPA: putative leucine-rich repeat receptor-like ... 74 9e-12 gb|AFW80071.1| putative leucine-rich repeat receptor-like protei... 74 2e-11 ref|XP_003534863.1| PREDICTED: probable LRR receptor-like serine... 73 2e-11 ref|XP_003547622.1| PREDICTED: probable LRR receptor-like serine... 70 2e-10 ref|XP_002327600.1| predicted protein [Populus trichocarpa] gi|2... 69 5e-10 >tpg|DAA53431.1| TPA: putative leucine-rich repeat receptor-like protein kinase family protein [Zea mays] Length = 930 Score = 74.3 bits (181), Expect = 9e-12 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 2/61 (3%) Frame = +3 Query: 3 LQLLNLSFNKLKGEVPVNGIFRIASNFSVAGNSDLCGGIRELQLPPCRIK--KSGKQDEK 176 L L+LSFN L+GEVP GIF+I +N S+ GN+DLCGG+ EL+LPPC I KS K+++ Sbjct: 486 LSELDLSFNNLQGEVPKEGIFKILANLSITGNNDLCGGVTELRLPPCHINVVKSNKKEKL 545 Query: 177 K 179 K Sbjct: 546 K 546 >gb|AFW80071.1| putative leucine-rich repeat receptor-like protein kinase family protein [Zea mays] Length = 1067 Score = 73.6 bits (179), Expect = 2e-11 Identities = 38/60 (63%), Positives = 46/60 (76%) Frame = +3 Query: 3 LQLLNLSFNKLKGEVPVNGIFRIASNFSVAGNSDLCGGIRELQLPPCRIKKSGKQDEKKQ 182 L L+LSFN L+G+VP GIFRI+ NFSVAGNS LCGGI +L+L PCR K S K+ KK+ Sbjct: 625 LSELDLSFNSLQGQVPEGGIFRISRNFSVAGNSGLCGGIPQLRLQPCR-KNSLKKGSKKR 683 >ref|XP_003534863.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Glycine max] Length = 991 Score = 73.2 bits (178), Expect = 2e-11 Identities = 34/50 (68%), Positives = 38/50 (76%) Frame = +3 Query: 3 LQLLNLSFNKLKGEVPVNGIFRIASNFSVAGNSDLCGGIRELQLPPCRIK 152 L+LLN+SFN L GEVP G+F+ AS V GNS LCGGI EL LPPCRIK Sbjct: 561 LELLNVSFNMLDGEVPTEGVFQNASGLGVIGNSKLCGGISELHLPPCRIK 610 >ref|XP_003547622.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Glycine max] Length = 991 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = +3 Query: 3 LQLLNLSFNKLKGEVPVNGIFRIASNFSVAGNSDLCGGIRELQLPPCRIK 152 L+ N+SFN L+GEVP G+FR AS F + GNS+LCGGI EL LPPC IK Sbjct: 566 LEYFNVSFNMLEGEVPTEGVFRNASGFVMTGNSNLCGGIFELHLPPCPIK 615 >ref|XP_002327600.1| predicted protein [Populus trichocarpa] gi|222836154|gb|EEE74575.1| predicted protein [Populus trichocarpa] Length = 985 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/59 (54%), Positives = 41/59 (69%) Frame = +3 Query: 3 LQLLNLSFNKLKGEVPVNGIFRIASNFSVAGNSDLCGGIRELQLPPCRIKKSGKQDEKK 179 LQ L+LSFN L+GEVP+NG+F S S+AGN +LCGGI +L LP CR K + + K Sbjct: 549 LQSLDLSFNDLEGEVPMNGVFENTSAISIAGNKNLCGGILQLNLPTCRSKSTKPKSSTK 607