BLASTX nr result
ID: Coptis25_contig00011538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00011538 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632656.1| PREDICTED: uncharacterized protein LOC100854... 71 8e-11 ref|XP_002532545.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_003632656.1| PREDICTED: uncharacterized protein LOC100854478 [Vitis vinifera] Length = 257 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/61 (55%), Positives = 46/61 (75%) Frame = +3 Query: 75 MTEFRPTVYFPVVFFDGECEIDIGNIGIYSTLDFNKLQSILSQKIGISPHQLTISLVFRK 254 M E V FPVVFFDGE EI+IG++ ++ +++F QSILSQKIGISPHQ++I L ++ Sbjct: 1 MMEINAGVSFPVVFFDGEREINIGDVVVFPSMEFKNFQSILSQKIGISPHQISIFLDCQR 60 Query: 255 K 257 K Sbjct: 61 K 61 >ref|XP_002532545.1| conserved hypothetical protein [Ricinus communis] gi|223527734|gb|EEF29839.1| conserved hypothetical protein [Ricinus communis] Length = 211 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = +3 Query: 102 FPVVFFDGECEIDIGNIGIYSTLDFNKLQSILSQKIGISPHQLTISLVFRKK 257 FP V FDGE E +GNI I +L+F LQSI+S+K+ +SPHQ +I L KK Sbjct: 4 FPAVLFDGEQETSLGNILISPSLNFKVLQSIISEKLVLSPHQFSIYLTDTKK 55