BLASTX nr result
ID: Coptis25_contig00011418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00011418 (675 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB96761.1| ferredoxin-dependent glutamate synthase [Glycine ... 67 4e-09 ref|XP_003521135.1| PREDICTED: ferredoxin-dependent glutamate sy... 67 4e-09 ref|XP_002526914.1| glutamate synthase, putative [Ricinus commun... 67 4e-09 ref|XP_002308884.1| predicted protein [Populus trichocarpa] gi|2... 65 9e-09 gb|ACF17655.1| putative ferredoxin-dependent glutamate synthase ... 65 1e-08 >gb|AAB96761.1| ferredoxin-dependent glutamate synthase [Glycine max] Length = 1023 Score = 66.6 bits (161), Expect = 4e-09 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +1 Query: 562 PQISDAIEHEKVVCKTMKIYNIDHAVCGRIAGVVAKKY 675 P+++DAIE+EKVV KT+KIYNID AVCGRIAGV+AKKY Sbjct: 756 PEVADAIENEKVVNKTIKIYNIDRAVCGRIAGVIAKKY 793 >ref|XP_003521135.1| PREDICTED: ferredoxin-dependent glutamate synthase, chloroplastic [Glycine max] Length = 1626 Score = 66.6 bits (161), Expect = 4e-09 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +1 Query: 562 PQISDAIEHEKVVCKTMKIYNIDHAVCGRIAGVVAKKY 675 P+++DAIE+EKVV KT+KIYNID AVCGRIAGV+AKKY Sbjct: 1354 PEVADAIENEKVVNKTIKIYNIDRAVCGRIAGVIAKKY 1391 >ref|XP_002526914.1| glutamate synthase, putative [Ricinus communis] gi|223533733|gb|EEF35467.1| glutamate synthase, putative [Ricinus communis] Length = 1632 Score = 66.6 bits (161), Expect = 4e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 562 PQISDAIEHEKVVCKTMKIYNIDHAVCGRIAGVVAKKY 675 PQI DAIE+EK+V KT+KIYN+D AVCGRIAGVVAKKY Sbjct: 1366 PQILDAIENEKIVNKTIKIYNVDRAVCGRIAGVVAKKY 1403 >ref|XP_002308884.1| predicted protein [Populus trichocarpa] gi|222854860|gb|EEE92407.1| predicted protein [Populus trichocarpa] Length = 1628 Score = 65.5 bits (158), Expect = 9e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +1 Query: 562 PQISDAIEHEKVVCKTMKIYNIDHAVCGRIAGVVAKKY 675 P+I DAIE+EKV+ KT+KIYN+D AVCGRIAGVVAKKY Sbjct: 1360 PEILDAIENEKVINKTIKIYNVDRAVCGRIAGVVAKKY 1397 >gb|ACF17655.1| putative ferredoxin-dependent glutamate synthase 1 [Capsicum annuum] Length = 1625 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 562 PQISDAIEHEKVVCKTMKIYNIDHAVCGRIAGVVAKKY 675 P+ISDAIE+EKVV KT++IYNID AVCGRIAG VAKKY Sbjct: 1353 PKISDAIENEKVVNKTVEIYNIDRAVCGRIAGAVAKKY 1390