BLASTX nr result
ID: Coptis25_contig00011245
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00011245 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002259198.1| hypothetical protein, conserved in Plasmodiu... 66 3e-09 ref|YP_004895127.1| mg1076 gene product [Megavirus chiliensis] g... 55 8e-06 >ref|XP_002259198.1| hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H] gi|193809269|emb|CAQ39971.1| hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H] Length = 721 Score = 66.2 bits (160), Expect = 3e-09 Identities = 40/110 (36%), Positives = 50/110 (45%) Frame = -2 Query: 332 HKYLHHHPKQRHKV*KFLRHPNRCQVYLH*PNQSQMYSHYANQCRKNLHHPNHPQKYSHN 153 H+ +HH + H+ N Q LH N Q H N ++N H NH QK H Sbjct: 244 HRQQNHHQQNHHQ-------QNHHQQNLHQQNHHQQNHHQQNHHQQNHHQQNHHQKNHHQ 296 Query: 152 PNQCQDSLHQQPDEW*KLSHHLNRCQMNLHLPNHSQKYSHYANECQKSLH 3 N Q +LHQQ L H N Q NLH NH Q+ H N Q++LH Sbjct: 297 QNLHQQNLHQQKHHQQNL-HQQNLHQQNLHQQNHHQQNHHQQNLHQQNLH 345 Score = 60.1 bits (144), Expect = 2e-07 Identities = 39/114 (34%), Positives = 48/114 (42%), Gaps = 4/114 (3%) Frame = -2 Query: 332 HKYLHHHPKQRHKV*KFLRHPNRCQVYLH*PNQSQMYSHYANQCRKNLHHPNHPQKYSHN 153 H +HH K H+ N Q LH Q H N ++NLH NH Q+ H Sbjct: 284 HHQQNHHQKNHHQ-------QNLHQQNLHQQKHHQQNLHQQNLHQQNLHQQNHHQQNHHQ 336 Query: 152 PNQCQDSLHQQPDEW*KL----SHHLNRCQMNLHLPNHSQKYSHYANECQKSLH 3 N Q +LHQQ L H N Q NLH NH Q+ H N Q++ H Sbjct: 337 QNLHQQNLHQQNHHQQNLHQQNHHQQNLHQQNLHQQNHHQQNHHQQNHHQQNHH 390 >ref|YP_004895127.1| mg1076 gene product [Megavirus chiliensis] gi|350611113|gb|AEQ32557.1| hypothetical protein [Megavirus chiliensis] Length = 153 Score = 54.7 bits (130), Expect = 8e-06 Identities = 37/103 (35%), Positives = 50/103 (48%), Gaps = 9/103 (8%) Frame = -1 Query: 282 FAPPKPVPGVFTLAKPVTDVFTLRKPVPEEFTPPKPSTEVFT*PKPVPGFFTS------- 124 F P K P FT K V++ F K VPE+FTP K + E F K VP + S Sbjct: 12 FTPEKFTPKKFTPEKYVSEKFVSEKFVPEKFTPKKFTPEKFIPEKYVPEKYVSEKYVPEK 71 Query: 123 --TARRVVETFAPPKPVPDEFTPPKPFTEVFTLRKRVPEVFAS 1 + + V E + K VP+++ P K E +T K VPE F + Sbjct: 72 YVSEKYVPEKYVSEKYVPEKYIPEKYTPEKYTSEKYVPENFTN 114