BLASTX nr result
ID: Coptis25_contig00011238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00011238 (488 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30029.3| unnamed protein product [Vitis vinifera] 65 4e-09 >emb|CBI30029.3| unnamed protein product [Vitis vinifera] Length = 1695 Score = 65.5 bits (158), Expect = 4e-09 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = -3 Query: 174 PLPSTVNLSIFGSDPPLPTNSN-GGVLLLDSSWNAAENRFRVASNACFDGQSLDWASSA 1 PLPS +NLSI GS+PP N+ +L SS + AENRFR AS ACFDG +LDWASSA Sbjct: 1515 PLPSVINLSILGSEPPSAVNNPIEESQILKSSQDMAENRFRAASRACFDG-TLDWASSA 1572