BLASTX nr result
ID: Coptis25_contig00011176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00011176 (391 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529154.1| conserved hypothetical protein [Ricinus comm... 79 4e-13 ref|XP_002281785.1| PREDICTED: uncharacterized protein LOC100247... 79 4e-13 ref|XP_002893575.1| hypothetical protein ARALYDRAFT_473173 [Arab... 75 7e-12 ref|NP_564334.1| metallo-beta-lactamase domain-containing protei... 73 3e-11 ref|XP_002312382.1| predicted protein [Populus trichocarpa] gi|2... 72 4e-11 >ref|XP_002529154.1| conserved hypothetical protein [Ricinus communis] gi|223531433|gb|EEF33267.1| conserved hypothetical protein [Ricinus communis] Length = 336 Score = 79.0 bits (193), Expect = 4e-13 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = +1 Query: 1 GELDSKGLLASIVRSEGTMESFKELLSKEVPDAEVLESAPGVPLEILAP 147 G+LD+KGLLASI+RSEGT+ESFKELL+KE+PD+ VLE PGVPL+I AP Sbjct: 288 GDLDAKGLLASIIRSEGTIESFKELLAKELPDSRVLEPTPGVPLQISAP 336 >ref|XP_002281785.1| PREDICTED: uncharacterized protein LOC100247534 [Vitis vinifera] gi|297737856|emb|CBI27057.3| unnamed protein product [Vitis vinifera] Length = 340 Score = 79.0 bits (193), Expect = 4e-13 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = +1 Query: 1 GELDSKGLLASIVRSEGTMESFKELLSKEVPDAEVLESAPGVPLEILAP 147 G+LDSKGLLASIV+SEGT+ESFKELL KE+PDA++LE PGVPLEI P Sbjct: 288 GDLDSKGLLASIVQSEGTVESFKELLHKELPDAQILEPTPGVPLEISPP 336 >ref|XP_002893575.1| hypothetical protein ARALYDRAFT_473173 [Arabidopsis lyrata subsp. lyrata] gi|297339417|gb|EFH69834.1| hypothetical protein ARALYDRAFT_473173 [Arabidopsis lyrata subsp. lyrata] Length = 350 Score = 74.7 bits (182), Expect = 7e-12 Identities = 35/49 (71%), Positives = 44/49 (89%) Frame = +1 Query: 1 GELDSKGLLASIVRSEGTMESFKELLSKEVPDAEVLESAPGVPLEILAP 147 GEL++KGLLASI++ EGT+ESFKELL KE+P+A+VLE G+PLEILAP Sbjct: 298 GELEAKGLLASIIKKEGTIESFKELLLKELPEAQVLEPIAGIPLEILAP 346 >ref|NP_564334.1| metallo-beta-lactamase domain-containing protein [Arabidopsis thaliana] gi|12321412|gb|AAG50777.1|AC079288_6 unknown protein [Arabidopsis thaliana] gi|12323515|gb|AAG51727.1|AC068667_6 unknown protein; 129333-127623 [Arabidopsis thaliana] gi|14596083|gb|AAK68769.1| Unknown protein [Arabidopsis thaliana] gi|18377530|gb|AAL66931.1| unknown protein [Arabidopsis thaliana] gi|332192998|gb|AEE31119.1| metallo-beta-lactamase domain-containing protein [Arabidopsis thaliana] Length = 350 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/49 (69%), Positives = 43/49 (87%) Frame = +1 Query: 1 GELDSKGLLASIVRSEGTMESFKELLSKEVPDAEVLESAPGVPLEILAP 147 GEL++KGLLAS+V+ EGT+ESFKELL KE+P+A+VLE G+PLEIL P Sbjct: 298 GELEAKGLLASLVKKEGTIESFKELLLKELPEAQVLEPIAGIPLEILVP 346 >ref|XP_002312382.1| predicted protein [Populus trichocarpa] gi|222852202|gb|EEE89749.1| predicted protein [Populus trichocarpa] Length = 345 Score = 72.4 bits (176), Expect = 4e-11 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +1 Query: 1 GELDSKGLLASIVRSEGTMESFKELLSKEVPDAEVLESAPGVPLEILAP 147 G+LD KG LASI+++EGT+ESFKELL+KE+PD + LE PGVPLEI P Sbjct: 297 GDLDGKGFLASIIQAEGTVESFKELLAKELPDTQALEPTPGVPLEISEP 345