BLASTX nr result
ID: Coptis25_contig00010975
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00010975 (443 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002872645.1| aminomethyltransferase [Arabidopsis lyrata s... 121 7e-26 emb|CAB40954.1| putative protein [Arabidopsis thaliana] gi|72679... 116 2e-24 ref|NP_192950.2| glycine cleavage T-protein family protein [Arab... 116 2e-24 ref|XP_002509611.1| aminomethyltransferase, putative [Ricinus co... 114 8e-24 ref|XP_003538724.1| PREDICTED: putative transferase CAF17 homolo... 111 5e-23 >ref|XP_002872645.1| aminomethyltransferase [Arabidopsis lyrata subsp. lyrata] gi|297318482|gb|EFH48904.1| aminomethyltransferase [Arabidopsis lyrata subsp. lyrata] Length = 393 Score = 121 bits (303), Expect = 7e-26 Identities = 55/71 (77%), Positives = 64/71 (90%) Frame = -3 Query: 213 VIRFRGPDTIKFLQGLLTNDIKRFAESTGEKKSYLSTPNVATVSTPPMYAALLTPQGRFL 34 V+RF GPDT+KFLQGLLTND++RF ES+GEK S + TPN+A+VSTPPMYAALLTPQGRFL Sbjct: 40 VVRFSGPDTVKFLQGLLTNDVRRFGESSGEKNSAVPTPNMASVSTPPMYAALLTPQGRFL 99 Query: 33 YDFFLYKPPQS 1 YDFFLY P +S Sbjct: 100 YDFFLYSPSKS 110 >emb|CAB40954.1| putative protein [Arabidopsis thaliana] gi|7267914|emb|CAB78256.1| putative protein [Arabidopsis thaliana] Length = 363 Score = 116 bits (291), Expect = 2e-24 Identities = 52/68 (76%), Positives = 61/68 (89%) Frame = -3 Query: 213 VIRFRGPDTIKFLQGLLTNDIKRFAESTGEKKSYLSTPNVATVSTPPMYAALLTPQGRFL 34 V+RF GPDT+KFLQGLLTND++RF ES+GEK S + TPN+A+V+ PPMYAALLTPQGRFL Sbjct: 40 VVRFSGPDTVKFLQGLLTNDVRRFGESSGEKNSAVPTPNMASVTNPPMYAALLTPQGRFL 99 Query: 33 YDFFLYKP 10 YDFFLY P Sbjct: 100 YDFFLYSP 107 >ref|NP_192950.2| glycine cleavage T-protein family protein [Arabidopsis thaliana] gi|22655070|gb|AAM98126.1| putative protein [Arabidopsis thaliana] gi|30725630|gb|AAP37837.1| At4g12130 [Arabidopsis thaliana] gi|332657699|gb|AEE83099.1| glycine cleavage T-protein family protein [Arabidopsis thaliana] Length = 393 Score = 116 bits (291), Expect = 2e-24 Identities = 52/68 (76%), Positives = 61/68 (89%) Frame = -3 Query: 213 VIRFRGPDTIKFLQGLLTNDIKRFAESTGEKKSYLSTPNVATVSTPPMYAALLTPQGRFL 34 V+RF GPDT+KFLQGLLTND++RF ES+GEK S + TPN+A+V+ PPMYAALLTPQGRFL Sbjct: 40 VVRFSGPDTVKFLQGLLTNDVRRFGESSGEKNSAVPTPNMASVTNPPMYAALLTPQGRFL 99 Query: 33 YDFFLYKP 10 YDFFLY P Sbjct: 100 YDFFLYSP 107 >ref|XP_002509611.1| aminomethyltransferase, putative [Ricinus communis] gi|223549510|gb|EEF50998.1| aminomethyltransferase, putative [Ricinus communis] Length = 391 Score = 114 bits (285), Expect = 8e-24 Identities = 53/71 (74%), Positives = 61/71 (85%) Frame = -3 Query: 213 VIRFRGPDTIKFLQGLLTNDIKRFAESTGEKKSYLSTPNVATVSTPPMYAALLTPQGRFL 34 VIRF GPDT+KFLQGLLTNDI+RF E+ E S+L TPN+ATVS PPMYAALLTPQGRFL Sbjct: 31 VIRFSGPDTVKFLQGLLTNDIRRFDETPSEATSFLPTPNLATVSVPPMYAALLTPQGRFL 90 Query: 33 YDFFLYKPPQS 1 YD FLY+P ++ Sbjct: 91 YDLFLYRPTRA 101 >ref|XP_003538724.1| PREDICTED: putative transferase CAF17 homolog, mitochondrial-like [Glycine max] Length = 410 Score = 111 bits (278), Expect = 5e-23 Identities = 50/69 (72%), Positives = 57/69 (82%) Frame = -3 Query: 213 VIRFRGPDTIKFLQGLLTNDIKRFAESTGEKKSYLSTPNVATVSTPPMYAALLTPQGRFL 34 VIRFRGPDT+KFLQGLLTND++ F E+ G++ L TPNV S PP+YAALLTPQGRFL Sbjct: 50 VIRFRGPDTLKFLQGLLTNDVRNFGEAVGDRTENLPTPNVPATSVPPIYAALLTPQGRFL 109 Query: 33 YDFFLYKPP 7 YD FLYKPP Sbjct: 110 YDLFLYKPP 118