BLASTX nr result
ID: Coptis25_contig00010822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00010822 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20469.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_002283181.1| PREDICTED: uncharacterized protein LOC100265... 59 5e-07 >emb|CBI20469.3| unnamed protein product [Vitis vinifera] Length = 281 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/59 (52%), Positives = 41/59 (69%), Gaps = 1/59 (1%) Frame = -2 Query: 202 RIVFGGVPTLEEAKEATSELKDALEMVYFPSSKAI-GWVKSSTVVQEPGQRYSEADACV 29 R+VFGGVPTL+EAKEATSELKDAL+ +Y S++I V+ ++Q + E ACV Sbjct: 137 RVVFGGVPTLQEAKEATSELKDALDQLYLSPSRSIRSGVQQLGLLQIANSDHLETKACV 195 >ref|XP_002283181.1| PREDICTED: uncharacterized protein LOC100265933 [Vitis vinifera] Length = 339 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/59 (52%), Positives = 41/59 (69%), Gaps = 1/59 (1%) Frame = -2 Query: 202 RIVFGGVPTLEEAKEATSELKDALEMVYFPSSKAI-GWVKSSTVVQEPGQRYSEADACV 29 R+VFGGVPTL+EAKEATSELKDAL+ +Y S++I V+ ++Q + E ACV Sbjct: 91 RVVFGGVPTLQEAKEATSELKDALDQLYLSPSRSIRSGVQQLGLLQIANSDHLETKACV 149