BLASTX nr result
ID: Coptis25_contig00010772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00010772 (388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517228.1| ATP synthase epsilon chain, mitochondrial, p... 107 1e-21 ref|NP_175576.1| ATP synthase subunit epsilon [Arabidopsis thali... 106 2e-21 ref|XP_002891649.1| ATP synthase epsilon chain, mitochondrial [A... 106 2e-21 gb|ACS83605.1| ATP synthase epsilon subunit 1 [Gossypium hirsutum] 103 2e-20 emb|CAD31844.1| putative epsilon subunit of mitochondrial F1-ATP... 100 9e-20 >ref|XP_002517228.1| ATP synthase epsilon chain, mitochondrial, putative [Ricinus communis] gi|223543599|gb|EEF45128.1| ATP synthase epsilon chain, mitochondrial, putative [Ricinus communis] Length = 70 Score = 107 bits (266), Expect = 1e-21 Identities = 48/53 (90%), Positives = 52/53 (98%) Frame = +3 Query: 228 MASNAAVPFWRAAGMTYISYSNICASLVRNCLKEPHKSEAINREKVHFSVSKW 386 MASNAAVPFWRAAGMTYI+YSNICA+LVRNCLKEPHK+EA+ REKVHFSVSKW Sbjct: 1 MASNAAVPFWRAAGMTYITYSNICANLVRNCLKEPHKTEALTREKVHFSVSKW 53 >ref|NP_175576.1| ATP synthase subunit epsilon [Arabidopsis thaliana] gi|2493052|sp|Q96253.3|ATP5E_ARATH RecName: Full=ATP synthase subunit epsilon, mitochondrial; Short=ATPase subunit epsilon gi|12321688|gb|AAG50890.1|AC025294_28 epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] gi|1655486|dbj|BAA13602.1| epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] gi|18252167|gb|AAL61916.1| epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] gi|21386911|gb|AAM47859.1| epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] gi|332194574|gb|AEE32695.1| ATP synthase subunit epsilon [Arabidopsis thaliana] Length = 70 Score = 106 bits (264), Expect = 2e-21 Identities = 47/53 (88%), Positives = 52/53 (98%) Frame = +3 Query: 228 MASNAAVPFWRAAGMTYISYSNICASLVRNCLKEPHKSEAINREKVHFSVSKW 386 MASNAAVPFWRAAGMTYISYSNICA++VRNCLKEPHK+EA+ REKVHFS+SKW Sbjct: 1 MASNAAVPFWRAAGMTYISYSNICANIVRNCLKEPHKAEALTREKVHFSLSKW 53 >ref|XP_002891649.1| ATP synthase epsilon chain, mitochondrial [Arabidopsis lyrata subsp. lyrata] gi|297337491|gb|EFH67908.1| ATP synthase epsilon chain, mitochondrial [Arabidopsis lyrata subsp. lyrata] Length = 70 Score = 106 bits (264), Expect = 2e-21 Identities = 47/53 (88%), Positives = 52/53 (98%) Frame = +3 Query: 228 MASNAAVPFWRAAGMTYISYSNICASLVRNCLKEPHKSEAINREKVHFSVSKW 386 MASNAAVPFWRAAGMTYISYSNICA++VRNCLKEPHK+EA+ REKVHFS+SKW Sbjct: 1 MASNAAVPFWRAAGMTYISYSNICANIVRNCLKEPHKAEALTREKVHFSLSKW 53 >gb|ACS83605.1| ATP synthase epsilon subunit 1 [Gossypium hirsutum] Length = 70 Score = 103 bits (256), Expect = 2e-20 Identities = 45/53 (84%), Positives = 52/53 (98%) Frame = +3 Query: 228 MASNAAVPFWRAAGMTYISYSNICASLVRNCLKEPHKSEAINREKVHFSVSKW 386 M SNAAVPFWRAAGMTYI+YSNICA+LVRNCLKEP+K+EA++REKVHFS+SKW Sbjct: 1 MTSNAAVPFWRAAGMTYITYSNICANLVRNCLKEPYKTEALSREKVHFSISKW 53 >emb|CAD31844.1| putative epsilon subunit of mitochondrial F1-ATPase [Cicer arietinum] Length = 68 Score = 100 bits (250), Expect = 9e-20 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +3 Query: 228 MASNAAVPFWRAAGMTYISYSNICASLVRNCLKEPHKSEAINREKVHFSVSKW 386 MAS AVPFWRAAGMTYI+YSNICA+LVRNCLKEPHK+E ++REKVHFS+SKW Sbjct: 1 MASTGAVPFWRAAGMTYITYSNICANLVRNCLKEPHKTEVLSREKVHFSLSKW 53