BLASTX nr result
ID: Coptis25_contig00010527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00010527 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004155438.1| PREDICTED: putative 12-oxophytodienoate redu... 102 3e-20 ref|XP_002526420.1| 12-oxophytodienoate reductase opr, putative ... 100 1e-19 ref|XP_004155439.1| PREDICTED: putative 12-oxophytodienoate redu... 100 2e-19 ref|XP_004151589.1| PREDICTED: 12-oxophytodienoate reductase 1-l... 100 2e-19 ref|XP_004136880.1| PREDICTED: LOW QUALITY PROTEIN: putative 12-... 100 2e-19 >ref|XP_004155438.1| PREDICTED: putative 12-oxophytodienoate reductase 11-like [Cucumis sativus] Length = 369 Score = 102 bits (255), Expect = 3e-20 Identities = 47/59 (79%), Positives = 53/59 (89%) Frame = +1 Query: 169 MAKSLNKYDILYCHMVEPRMKLVGEKLETPHSLLPMRKAFKGTFIAVGGYVEEDGNKAI 345 MA++LNKY ILYCHMVEPRM+ EK+ETPHSLLPMRKAFKGTFIA GGY +EDGN+AI Sbjct: 256 MAENLNKYGILYCHMVEPRMETASEKVETPHSLLPMRKAFKGTFIAAGGYDKEDGNRAI 314 >ref|XP_002526420.1| 12-oxophytodienoate reductase opr, putative [Ricinus communis] gi|223534282|gb|EEF35996.1| 12-oxophytodienoate reductase opr, putative [Ricinus communis] Length = 278 Score = 100 bits (250), Expect = 1e-19 Identities = 48/59 (81%), Positives = 50/59 (84%) Frame = +1 Query: 169 MAKSLNKYDILYCHMVEPRMKLVGEKLETPHSLLPMRKAFKGTFIAVGGYVEEDGNKAI 345 M +SLNKY ILYCHMVEPRMK VGEK E P SLLPMRKAFKGTFIA GGY EDGNKA+ Sbjct: 163 MVESLNKYGILYCHMVEPRMKTVGEKSECPQSLLPMRKAFKGTFIAAGGYDMEDGNKAV 221 >ref|XP_004155439.1| PREDICTED: putative 12-oxophytodienoate reductase 11-like [Cucumis sativus] Length = 369 Score = 99.8 bits (247), Expect = 2e-19 Identities = 46/59 (77%), Positives = 53/59 (89%) Frame = +1 Query: 169 MAKSLNKYDILYCHMVEPRMKLVGEKLETPHSLLPMRKAFKGTFIAVGGYVEEDGNKAI 345 MA++LNKY ILYCHMVEPRM+ V EK+E+P SLLPMRKAFKGTFIA GGY +EDGN+AI Sbjct: 256 MAENLNKYGILYCHMVEPRMETVSEKVESPRSLLPMRKAFKGTFIAAGGYDKEDGNRAI 314 >ref|XP_004151589.1| PREDICTED: 12-oxophytodienoate reductase 1-like, partial [Cucumis sativus] Length = 194 Score = 99.8 bits (247), Expect = 2e-19 Identities = 46/59 (77%), Positives = 53/59 (89%) Frame = +1 Query: 169 MAKSLNKYDILYCHMVEPRMKLVGEKLETPHSLLPMRKAFKGTFIAVGGYVEEDGNKAI 345 MA++LNKY ILYCHMVEPRM+ V EK+E+P SLLPMRKAFKGTFIA GGY +EDGN+AI Sbjct: 81 MAENLNKYGILYCHMVEPRMETVSEKVESPRSLLPMRKAFKGTFIAAGGYDKEDGNRAI 139 >ref|XP_004136880.1| PREDICTED: LOW QUALITY PROTEIN: putative 12-oxophytodienoate reductase 11-like [Cucumis sativus] Length = 363 Score = 99.8 bits (247), Expect = 2e-19 Identities = 46/59 (77%), Positives = 53/59 (89%) Frame = +1 Query: 169 MAKSLNKYDILYCHMVEPRMKLVGEKLETPHSLLPMRKAFKGTFIAVGGYVEEDGNKAI 345 MA++LNKY ILYCHMVEPRM+ V EK+E+P SLLPMRKAFKGTFIA GGY +EDGN+AI Sbjct: 250 MAENLNKYGILYCHMVEPRMETVSEKVESPRSLLPMRKAFKGTFIAAGGYDKEDGNRAI 308