BLASTX nr result
ID: Coptis25_contig00010079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00010079 (722 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631297.1| PREDICTED: uncharacterized protein LOC100246... 73 7e-11 emb|CBI32086.3| unnamed protein product [Vitis vinifera] 73 7e-11 ref|XP_002524062.1| conserved hypothetical protein [Ricinus comm... 66 8e-09 ref|XP_002322780.1| predicted protein [Populus trichocarpa] gi|2... 65 1e-08 gb|ABF71999.1| hypothetical protein MA4_111B14.30 [Musa acuminata] 64 4e-08 >ref|XP_003631297.1| PREDICTED: uncharacterized protein LOC100246722 [Vitis vinifera] Length = 2226 Score = 72.8 bits (177), Expect = 7e-11 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +1 Query: 1 IDLLLASTPQSDDLLWILWELCGLSSSDLRRQVLLALGHFPEA 129 +D LL+STPQS++ LW+LWELCGLS SD RQ LLALGHFPEA Sbjct: 648 VDRLLSSTPQSEEFLWVLWELCGLSRSDSGRQALLALGHFPEA 690 >emb|CBI32086.3| unnamed protein product [Vitis vinifera] Length = 2230 Score = 72.8 bits (177), Expect = 7e-11 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +1 Query: 1 IDLLLASTPQSDDLLWILWELCGLSSSDLRRQVLLALGHFPEA 129 +D LL+STPQS++ LW+LWELCGLS SD RQ LLALGHFPEA Sbjct: 648 VDRLLSSTPQSEEFLWVLWELCGLSRSDSGRQALLALGHFPEA 690 >ref|XP_002524062.1| conserved hypothetical protein [Ricinus communis] gi|223536630|gb|EEF38272.1| conserved hypothetical protein [Ricinus communis] Length = 2100 Score = 65.9 bits (159), Expect = 8e-09 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +1 Query: 1 IDLLLASTPQSDDLLWILWELCGLSSSDLRRQVLLALGHFPEA 129 ID L+AS P S++ LW+LWELCGLS SD RQ LL LG+FPEA Sbjct: 644 IDRLVASAPHSEEFLWVLWELCGLSRSDCGRQALLVLGYFPEA 686 >ref|XP_002322780.1| predicted protein [Populus trichocarpa] gi|222867410|gb|EEF04541.1| predicted protein [Populus trichocarpa] Length = 885 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +1 Query: 1 IDLLLASTPQSDDLLWILWELCGLSSSDLRRQVLLALGHFPEA 129 ID LL STP ++ LW+LWELCGLS SD RQ LL LG+FPEA Sbjct: 118 IDRLLISTPHPEEFLWVLWELCGLSRSDCGRQALLVLGYFPEA 160 >gb|ABF71999.1| hypothetical protein MA4_111B14.30 [Musa acuminata] Length = 1138 Score = 63.5 bits (153), Expect = 4e-08 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = +1 Query: 1 IDLLLASTPQSDDLLWILWELCGLSSSDLRRQVLLALGHFPEAREV 138 ID LL + PQ DDLLWILWELC +S S+ RQ LL LGHFPE V Sbjct: 510 IDRLLNTGPQYDDLLWILWELCAISRSESGRQALLVLGHFPEVISV 555