BLASTX nr result
ID: Coptis25_contig00009733
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00009733 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74250.1| hypothetical protein VITISV_019089 [Vitis vinifera] 65 5e-11 gb|AFK44959.1| unknown [Lotus japonicus] 69 3e-10 ref|XP_004148806.1| PREDICTED: uncharacterized protein LOC101222... 68 9e-10 ref|XP_003556146.1| PREDICTED: uncharacterized protein LOC100813... 68 9e-10 ref|XP_003556145.1| PREDICTED: uncharacterized protein LOC100813... 68 9e-10 >emb|CAN74250.1| hypothetical protein VITISV_019089 [Vitis vinifera] Length = 337 Score = 65.5 bits (158), Expect(2) = 5e-11 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 97 IFRPFVGYKEVRLVTKESKHRGGDPLILCFVD 2 IFRPFVGYKEVRLV+KESKHRG DPL+LCFVD Sbjct: 219 IFRPFVGYKEVRLVSKESKHRGRDPLVLCFVD 250 Score = 26.6 bits (57), Expect(2) = 5e-11 Identities = 11/17 (64%), Positives = 16/17 (94%) Frame = -1 Query: 248 STKREVARIL*NIVSLP 198 ST+REVARIL ++++LP Sbjct: 195 STRREVARILQDVITLP 211 >gb|AFK44959.1| unknown [Lotus japonicus] Length = 239 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 97 IFRPFVGYKEVRLVTKESKHRGGDPLILCFVD 2 IFRPFVGY+EVRLVTKESKHRGGDPLILCFVD Sbjct: 159 IFRPFVGYREVRLVTKESKHRGGDPLILCFVD 190 >ref|XP_004148806.1| PREDICTED: uncharacterized protein LOC101222348 isoform 1 [Cucumis sativus] gi|449462156|ref|XP_004148807.1| PREDICTED: uncharacterized protein LOC101222348 isoform 2 [Cucumis sativus] Length = 257 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 97 IFRPFVGYKEVRLVTKESKHRGGDPLILCFVD 2 IFRPFVGYKE+RLV+KESKHRGGDPLILCFVD Sbjct: 177 IFRPFVGYKELRLVSKESKHRGGDPLILCFVD 208 >ref|XP_003556146.1| PREDICTED: uncharacterized protein LOC100813445 isoform 2 [Glycine max] Length = 245 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 97 IFRPFVGYKEVRLVTKESKHRGGDPLILCFVD 2 IFRPFVGY+EVRLV+KESKHRGGDPLILCFVD Sbjct: 165 IFRPFVGYREVRLVSKESKHRGGDPLILCFVD 196 >ref|XP_003556145.1| PREDICTED: uncharacterized protein LOC100813445 isoform 1 [Glycine max] Length = 252 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 97 IFRPFVGYKEVRLVTKESKHRGGDPLILCFVD 2 IFRPFVGY+EVRLV+KESKHRGGDPLILCFVD Sbjct: 172 IFRPFVGYREVRLVSKESKHRGGDPLILCFVD 203