BLASTX nr result
ID: Coptis25_contig00009707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00009707 (378 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC55157.1| purple acid phosphatase [Nicotiana tabacum] 79 7e-14 ref|XP_002274392.1| PREDICTED: purple acid phosphatase 2 [Vitis ... 79 2e-13 gb|AAD20634.1| purple acid phosphatase precursor [Anchusa offici... 79 3e-13 dbj|BAC55154.1| purple acid phosphatase [Nicotiana tabacum] 77 4e-13 ref|XP_002280873.1| PREDICTED: purple acid phosphatase 2 [Vitis ... 79 4e-13 >dbj|BAC55157.1| purple acid phosphatase [Nicotiana tabacum] Length = 470 Score = 79.3 bits (194), Expect(2) = 7e-14 Identities = 35/50 (70%), Positives = 39/50 (78%) Frame = +2 Query: 209 RISNRVYKVSNGNCTPVLNSSAPVYITSGDGGNIEGLANKFTEPQPSYSA 358 R+SN Y + NG CTPV + SAP+YIT GDGGNIEGLAN TEPQP YSA Sbjct: 366 RVSNVAYNIVNGKCTPVRDQSAPIYITIGDGGNIEGLANNMTEPQPEYSA 415 Score = 22.3 bits (46), Expect(2) = 7e-14 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 358 YSWHRNQ 378 YSWHRNQ Sbjct: 436 YSWHRNQ 442 >ref|XP_002274392.1| PREDICTED: purple acid phosphatase 2 [Vitis vinifera] gi|297744761|emb|CBI38023.3| unnamed protein product [Vitis vinifera] Length = 471 Score = 79.3 bits (194), Expect(2) = 2e-13 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = +2 Query: 209 RISNRVYKVSNGNCTPVLNSSAPVYITSGDGGNIEGLANKFTEPQPSYSA 358 R+SN Y + NG CTPV + SAPVYIT GDGGNIEGLAN TEPQP+YSA Sbjct: 369 RVSNIAYNIINGMCTPVKDQSAPVYITIGDGGNIEGLANNMTEPQPNYSA 418 Score = 21.2 bits (43), Expect(2) = 2e-13 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +1 Query: 358 YSWHRNQ 378 YSWHRN+ Sbjct: 439 YSWHRNE 445 >gb|AAD20634.1| purple acid phosphatase precursor [Anchusa officinalis] Length = 470 Score = 78.6 bits (192), Expect(2) = 3e-13 Identities = 37/50 (74%), Positives = 40/50 (80%) Frame = +2 Query: 209 RISNRVYKVSNGNCTPVLNSSAPVYITSGDGGNIEGLANKFTEPQPSYSA 358 RISN VY V NG CTPV +SSAP+YIT GDGGN+EGLA TEPQP YSA Sbjct: 366 RISNIVYNVVNGICTPVNDSSAPIYITIGDGGNLEGLAKNMTEPQPKYSA 415 Score = 21.2 bits (43), Expect(2) = 3e-13 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +1 Query: 358 YSWHRNQ 378 Y+WHRNQ Sbjct: 436 YAWHRNQ 442 >dbj|BAC55154.1| purple acid phosphatase [Nicotiana tabacum] Length = 461 Score = 77.0 bits (188), Expect(2) = 4e-13 Identities = 36/50 (72%), Positives = 38/50 (76%) Frame = +2 Query: 209 RISNRVYKVSNGNCTPVLNSSAPVYITSGDGGNIEGLANKFTEPQPSYSA 358 RISN YK+ +G CTP N SAPVYIT GDGGNIEGL K TEPQP YSA Sbjct: 361 RISNIDYKIVSGECTPASNPSAPVYITVGDGGNIEGLTTKMTEPQPKYSA 410 Score = 22.3 bits (46), Expect(2) = 4e-13 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 358 YSWHRNQ 378 YSWHRNQ Sbjct: 431 YSWHRNQ 437 >ref|XP_002280873.1| PREDICTED: purple acid phosphatase 2 [Vitis vinifera] gi|147782289|emb|CAN60822.1| hypothetical protein VITISV_037054 [Vitis vinifera] gi|302142576|emb|CBI19779.3| unnamed protein product [Vitis vinifera] Length = 467 Score = 79.0 bits (193), Expect = 4e-13 Identities = 37/50 (74%), Positives = 39/50 (78%) Frame = +2 Query: 209 RISNRVYKVSNGNCTPVLNSSAPVYITSGDGGNIEGLANKFTEPQPSYSA 358 RISN Y + NGNCTP+ N SAPVYIT GDGGN EGLA TEPQPSYSA Sbjct: 363 RISNIAYDIVNGNCTPIPNESAPVYITIGDGGNQEGLATGMTEPQPSYSA 412