BLASTX nr result
ID: Coptis25_contig00009519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00009519 (470 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16320.3| unnamed protein product [Vitis vinifera] 63 3e-08 ref|XP_002285194.1| PREDICTED: serine/threonine-protein phosphat... 63 3e-08 ref|XP_003597254.1| Serine/threonine protein phosphatase 6 regul... 61 8e-08 ref|NP_190105.3| SIT4 phosphatase-associated family protein [Ara... 60 2e-07 emb|CAB72157.1| putative protein [Arabidopsis thaliana] 60 2e-07 >emb|CBI16320.3| unnamed protein product [Vitis vinifera] Length = 790 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 469 GDFVMLLNVSSDEKILPAIYGELRPPLGKHRLK 371 GD +MLLNVSSDEK+LP YGELRPPLGKHRLK Sbjct: 305 GDLLMLLNVSSDEKVLPTTYGELRPPLGKHRLK 337 >ref|XP_002285194.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 3-like [Vitis vinifera] Length = 850 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 469 GDFVMLLNVSSDEKILPAIYGELRPPLGKHRLK 371 GD +MLLNVSSDEK+LP YGELRPPLGKHRLK Sbjct: 305 GDLLMLLNVSSDEKVLPTTYGELRPPLGKHRLK 337 >ref|XP_003597254.1| Serine/threonine protein phosphatase 6 regulatory subunit [Medicago truncatula] gi|355486302|gb|AES67505.1| Serine/threonine protein phosphatase 6 regulatory subunit [Medicago truncatula] Length = 874 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 469 GDFVMLLNVSSDEKILPAIYGELRPPLGKHRLK 371 G+ +MLLNVSSDEK+LP YGELRPPLGKHRLK Sbjct: 329 GELLMLLNVSSDEKVLPTTYGELRPPLGKHRLK 361 >ref|NP_190105.3| SIT4 phosphatase-associated family protein [Arabidopsis thaliana] gi|332644481|gb|AEE78002.1| SIT4 phosphatase-associated family protein [Arabidopsis thaliana] Length = 789 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 469 GDFVMLLNVSSDEKILPAIYGELRPPLGKHRLK 371 GDFV LLNV+SDEKILP YG+LRPPLG HRLK Sbjct: 306 GDFVALLNVTSDEKILPTTYGQLRPPLGSHRLK 338 >emb|CAB72157.1| putative protein [Arabidopsis thaliana] Length = 774 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 469 GDFVMLLNVSSDEKILPAIYGELRPPLGKHRLK 371 GDFV LLNV+SDEKILP YG+LRPPLG HRLK Sbjct: 250 GDFVALLNVTSDEKILPTTYGQLRPPLGSHRLK 282