BLASTX nr result
ID: Coptis25_contig00009475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00009475 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003530794.1| PREDICTED: phosphoglucomutase, cytoplasmic-l... 101 6e-20 ref|XP_003525238.1| PREDICTED: phosphoglucomutase, cytoplasmic-l... 101 6e-20 ref|NP_001154465.1| phosphoglucomutase [Arabidopsis thaliana] gi... 99 4e-19 ref|NP_177230.1| phosphoglucomutase [Arabidopsis thaliana] gi|12... 99 5e-19 ref|NP_173732.1| putative phosphoglucomutase [Arabidopsis thalia... 98 6e-19 >ref|XP_003530794.1| PREDICTED: phosphoglucomutase, cytoplasmic-like [Glycine max] Length = 582 Score = 101 bits (252), Expect = 6e-20 Identities = 47/59 (79%), Positives = 53/59 (89%) Frame = -2 Query: 179 MVMFKVTRVHTTPIDGQKPGTSGLRKKVKVFKEPHYLHNFVQATFNALSAEKFKGATLV 3 MV+F V+RV TTP DGQKPGTSGLRKKVKVF +PHYLHNFVQ+TFNAL+ EK +GATLV Sbjct: 1 MVLFNVSRVETTPFDGQKPGTSGLRKKVKVFVQPHYLHNFVQSTFNALTVEKVRGATLV 59 >ref|XP_003525238.1| PREDICTED: phosphoglucomutase, cytoplasmic-like [Glycine max] Length = 582 Score = 101 bits (252), Expect = 6e-20 Identities = 47/59 (79%), Positives = 53/59 (89%) Frame = -2 Query: 179 MVMFKVTRVHTTPIDGQKPGTSGLRKKVKVFKEPHYLHNFVQATFNALSAEKFKGATLV 3 MV+F V+RV TTP DGQKPGTSGLRKKVKVF +PHYLHNFVQ+TFNAL+ EK +GATLV Sbjct: 1 MVLFNVSRVETTPFDGQKPGTSGLRKKVKVFVQPHYLHNFVQSTFNALTVEKVRGATLV 59 >ref|NP_001154465.1| phosphoglucomutase [Arabidopsis thaliana] gi|332196986|gb|AEE35107.1| phosphoglucomutase [Arabidopsis thaliana] Length = 662 Score = 99.0 bits (245), Expect = 4e-19 Identities = 48/60 (80%), Positives = 54/60 (90%) Frame = -2 Query: 182 KMVMFKVTRVHTTPIDGQKPGTSGLRKKVKVFKEPHYLHNFVQATFNALSAEKFKGATLV 3 +MV FKV+ V T+PIDGQKPGTSGLRKKVKVFK+P+YL NFVQATFNAL+ EK KGATLV Sbjct: 77 EMVSFKVSLVSTSPIDGQKPGTSGLRKKVKVFKQPNYLENFVQATFNALTTEKVKGATLV 136 >ref|NP_177230.1| phosphoglucomutase [Arabidopsis thaliana] gi|12585324|sp|Q9SGC1.1|PGMC2_ARATH RecName: Full=Probable phosphoglucomutase, cytoplasmic 2; Short=PGM 2; AltName: Full=Glucose phosphomutase 2 gi|12324763|gb|AAG52345.1|AC011663_24 putative phosphoglucomutase; 31864-35570 [Arabidopsis thaliana] gi|19699055|gb|AAL90895.1| At1g70730/F5A18_9 [Arabidopsis thaliana] gi|27363248|gb|AAO11543.1| At1g70730/F5A18_9 [Arabidopsis thaliana] gi|110739105|dbj|BAF01469.1| putative phosphoglucomutase [Arabidopsis thaliana] gi|332196984|gb|AEE35105.1| phosphoglucomutase [Arabidopsis thaliana] Length = 585 Score = 98.6 bits (244), Expect = 5e-19 Identities = 48/59 (81%), Positives = 53/59 (89%) Frame = -2 Query: 179 MVMFKVTRVHTTPIDGQKPGTSGLRKKVKVFKEPHYLHNFVQATFNALSAEKFKGATLV 3 MV FKV+ V T+PIDGQKPGTSGLRKKVKVFK+P+YL NFVQATFNAL+ EK KGATLV Sbjct: 1 MVSFKVSLVSTSPIDGQKPGTSGLRKKVKVFKQPNYLENFVQATFNALTTEKVKGATLV 59 >ref|NP_173732.1| putative phosphoglucomutase [Arabidopsis thaliana] gi|322510058|sp|O49299.2|PGMC1_ARATH RecName: Full=Probable phosphoglucomutase, cytoplasmic 1; Short=PGM 1; AltName: Full=Glucose phosphomutase 1 gi|16649113|gb|AAL24408.1| phosphoglucomutase [Arabidopsis thaliana] gi|20148521|gb|AAM10151.1| phosphoglucomutase [Arabidopsis thaliana] gi|332192232|gb|AEE30353.1| putative phosphoglucomutase [Arabidopsis thaliana] Length = 583 Score = 98.2 bits (243), Expect = 6e-19 Identities = 47/58 (81%), Positives = 54/58 (93%) Frame = -2 Query: 176 VMFKVTRVHTTPIDGQKPGTSGLRKKVKVFKEPHYLHNFVQATFNALSAEKFKGATLV 3 ++FKV+ V T+PIDGQKPGTSGLRKKVKVFK+P+YL NFVQATFNAL+AEK KGATLV Sbjct: 1 MVFKVSTVSTSPIDGQKPGTSGLRKKVKVFKQPNYLENFVQATFNALTAEKVKGATLV 58