BLASTX nr result
ID: Coptis25_contig00008374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00008374 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266602.1| PREDICTED: uncharacterized protein LOC100261... 64 1e-08 emb|CAN71581.1| hypothetical protein VITISV_003231 [Vitis vinifera] 64 1e-08 ref|XP_002275055.1| PREDICTED: uncharacterized protein LOC100260... 63 2e-08 emb|CAN78204.1| hypothetical protein VITISV_019153 [Vitis vinifera] 63 3e-08 ref|XP_002517218.1| conserved hypothetical protein [Ricinus comm... 62 4e-08 >ref|XP_002266602.1| PREDICTED: uncharacterized protein LOC100261683 [Vitis vinifera] gi|297740496|emb|CBI30678.3| unnamed protein product [Vitis vinifera] Length = 530 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +3 Query: 9 IDWEDCIIETLLLHHVKEEEIEQGHYKRMLDLYVFD 116 IDWED +IETLLLHHVKE+EIE+GHY +LDL+VF+ Sbjct: 491 IDWEDFVIETLLLHHVKEDEIEKGHYNTLLDLHVFN 526 >emb|CAN71581.1| hypothetical protein VITISV_003231 [Vitis vinifera] Length = 503 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +3 Query: 9 IDWEDCIIETLLLHHVKEEEIEQGHYKRMLDLYVFD 116 IDWED +IETLLLHHVKE+EIE+GHY +LDL+VF+ Sbjct: 464 IDWEDFVIETLLLHHVKEDEIEKGHYNTLLDLHVFN 499 >ref|XP_002275055.1| PREDICTED: uncharacterized protein LOC100260157 [Vitis vinifera] gi|297745306|emb|CBI40386.3| unnamed protein product [Vitis vinifera] Length = 535 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 3 AYIDWEDCIIETLLLHHVKEEEIEQGHYKRMLDLYVFD 116 A IDWED IETLLLHHVKE+EIE+GHY +LDL+VF+ Sbjct: 494 ADIDWEDFAIETLLLHHVKEDEIEKGHYNTLLDLHVFN 531 >emb|CAN78204.1| hypothetical protein VITISV_019153 [Vitis vinifera] Length = 535 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +3 Query: 9 IDWEDCIIETLLLHHVKEEEIEQGHYKRMLDLYVFD 116 IDWED IETLLLHHVKE+EIE+GHY +LDL+VF+ Sbjct: 496 IDWEDFAIETLLLHHVKEDEIEKGHYNTLLDLHVFN 531 >ref|XP_002517218.1| conserved hypothetical protein [Ricinus communis] gi|223543589|gb|EEF45118.1| conserved hypothetical protein [Ricinus communis] Length = 532 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +3 Query: 9 IDWEDCIIETLLLHHVKEEEIEQGHYKRMLDLYVFD 116 IDWED +IETLLLH VKEEEIE+GHY +LDL+VF+ Sbjct: 493 IDWEDFVIETLLLHQVKEEEIEKGHYNTLLDLHVFN 528