BLASTX nr result
ID: Coptis25_contig00007587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00007587 (515 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517615.1| nucleic acid binding protein, putative [Rici... 101 6e-20 emb|CBI36301.3| unnamed protein product [Vitis vinifera] 98 8e-19 ref|XP_002269416.1| PREDICTED: DCC family protein At1g52590, chl... 98 8e-19 gb|ABQ42096.1| putative thioldisulphide oxidoreductase DCC [Sonn... 97 1e-18 gb|ABQ42095.1| putative thioldisulphide oxidoreductase DCC [Sonn... 97 1e-18 >ref|XP_002517615.1| nucleic acid binding protein, putative [Ricinus communis] gi|223543247|gb|EEF44779.1| nucleic acid binding protein, putative [Ricinus communis] Length = 180 Score = 101 bits (252), Expect = 6e-20 Identities = 53/76 (69%), Positives = 58/76 (76%) Frame = +3 Query: 288 NRKIRFEALQSESGKNLLRRSGRTPDDISSVVLVEKDRSYIKSDAVLKIMEYINXXXXXX 467 NRKIR+EALQSE+GK LLRRSGR PDDISSVVLVEKDRSYIKS+AVLKIMEYI+ Sbjct: 78 NRKIRYEALQSEAGKKLLRRSGRAPDDISSVVLVEKDRSYIKSEAVLKIMEYIDLPFPQL 137 Query: 468 XXXXXXXXXXVRDFVY 515 +RDFVY Sbjct: 138 AFFLQFVPLFIRDFVY 153 >emb|CBI36301.3| unnamed protein product [Vitis vinifera] Length = 119 Score = 97.8 bits (242), Expect = 8e-19 Identities = 51/76 (67%), Positives = 56/76 (73%) Frame = +3 Query: 288 NRKIRFEALQSESGKNLLRRSGRTPDDISSVVLVEKDRSYIKSDAVLKIMEYINXXXXXX 467 NR IRFEALQSE+GK LLRRSGR PDDISSVVLVEK+RSYIKS+AVLKIMEYI+ Sbjct: 23 NRSIRFEALQSEAGKKLLRRSGRAPDDISSVVLVEKERSYIKSEAVLKIMEYIDLPFPQL 82 Query: 468 XXXXXXXXXXVRDFVY 515 +RDF Y Sbjct: 83 AFFLQFVPLFIRDFAY 98 >ref|XP_002269416.1| PREDICTED: DCC family protein At1g52590, chloroplastic [Vitis vinifera] Length = 176 Score = 97.8 bits (242), Expect = 8e-19 Identities = 51/76 (67%), Positives = 56/76 (73%) Frame = +3 Query: 288 NRKIRFEALQSESGKNLLRRSGRTPDDISSVVLVEKDRSYIKSDAVLKIMEYINXXXXXX 467 NR IRFEALQSE+GK LLRRSGR PDDISSVVLVEK+RSYIKS+AVLKIMEYI+ Sbjct: 80 NRSIRFEALQSEAGKKLLRRSGRAPDDISSVVLVEKERSYIKSEAVLKIMEYIDLPFPQL 139 Query: 468 XXXXXXXXXXVRDFVY 515 +RDF Y Sbjct: 140 AFFLQFVPLFIRDFAY 155 >gb|ABQ42096.1| putative thioldisulphide oxidoreductase DCC [Sonneratia caseolaris] Length = 151 Score = 97.4 bits (241), Expect = 1e-18 Identities = 51/76 (67%), Positives = 58/76 (76%) Frame = +3 Query: 288 NRKIRFEALQSESGKNLLRRSGRTPDDISSVVLVEKDRSYIKSDAVLKIMEYINXXXXXX 467 NRKIRFEALQS++G+NLLRRS R PDDISSVVLVEKDR+YIKSDAVLKIMEYI+ Sbjct: 69 NRKIRFEALQSKAGRNLLRRSKRDPDDISSVVLVEKDRAYIKSDAVLKIMEYIDLPFPQL 128 Query: 468 XXXXXXXXXXVRDFVY 515 +RDF+Y Sbjct: 129 AFFLQFIPMFLRDFMY 144 >gb|ABQ42095.1| putative thioldisulphide oxidoreductase DCC [Sonneratia alba] Length = 151 Score = 97.4 bits (241), Expect = 1e-18 Identities = 51/76 (67%), Positives = 58/76 (76%) Frame = +3 Query: 288 NRKIRFEALQSESGKNLLRRSGRTPDDISSVVLVEKDRSYIKSDAVLKIMEYINXXXXXX 467 NR+IRFEALQSE+G+NLLRRS R PDDISSVVLVEKDR+YIKSDAVLKIMEYI+ Sbjct: 69 NREIRFEALQSEAGRNLLRRSKRDPDDISSVVLVEKDRAYIKSDAVLKIMEYIDLPFPQL 128 Query: 468 XXXXXXXXXXVRDFVY 515 +RDF+Y Sbjct: 129 AFFLQFIPVFLRDFMY 144