BLASTX nr result
ID: Coptis25_contig00007488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00007488 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW87395.1| hypothetical protein ZEAMMB73_638072, partial [Ze... 77 1e-12 gb|AFW73371.1| hypothetical protein ZEAMMB73_956340 [Zea mays] 77 1e-12 gb|AFW73370.1| hypothetical protein ZEAMMB73_956340 [Zea mays] 77 1e-12 ref|XP_003560565.1| PREDICTED: probable mannan synthase 9-like [... 77 2e-12 gb|AED99880.1| glycosyltransferase [Panax notoginseng] 77 2e-12 >gb|AFW87395.1| hypothetical protein ZEAMMB73_638072, partial [Zea mays] Length = 479 Score = 77.0 bits (188), Expect = 1e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 251 INEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLM 144 +NEAGGWKDRTTVEDMDLAVRASLKGWKFVY+GDLM Sbjct: 226 LNEAGGWKDRTTVEDMDLAVRASLKGWKFVYIGDLM 261 >gb|AFW73371.1| hypothetical protein ZEAMMB73_956340 [Zea mays] Length = 918 Score = 77.0 bits (188), Expect = 1e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 251 INEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLM 144 +NEAGGWKDRTTVEDMDLAVRASLKGWKFVY+GDLM Sbjct: 702 LNEAGGWKDRTTVEDMDLAVRASLKGWKFVYIGDLM 737 >gb|AFW73370.1| hypothetical protein ZEAMMB73_956340 [Zea mays] Length = 295 Score = 77.0 bits (188), Expect = 1e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 251 INEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLM 144 +NEAGGWKDRTTVEDMDLAVRASLKGWKFVY+GDLM Sbjct: 41 LNEAGGWKDRTTVEDMDLAVRASLKGWKFVYIGDLM 76 >ref|XP_003560565.1| PREDICTED: probable mannan synthase 9-like [Brachypodium distachyon] Length = 528 Score = 76.6 bits (187), Expect = 2e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 251 INEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLM 144 +NEAGGWKDRTTVEDMDLAVRASLKGWKFV+LGDLM Sbjct: 271 VNEAGGWKDRTTVEDMDLAVRASLKGWKFVFLGDLM 306 >gb|AED99880.1| glycosyltransferase [Panax notoginseng] Length = 465 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 251 INEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDL 147 INEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDL Sbjct: 275 INEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDL 309