BLASTX nr result
ID: Coptis25_contig00007398
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00007398 (229 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280724.1| PREDICTED: uncharacterized protein LOC100255... 57 1e-06 ref|NP_180658.3| protein kinase domain-containing protein [Arabi... 57 2e-06 ref|XP_002528550.1| protein kinase, putative [Ricinus communis] ... 56 3e-06 ref|XP_002321072.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002879296.1| kinase family protein [Arabidopsis lyrata su... 55 5e-06 >ref|XP_002280724.1| PREDICTED: uncharacterized protein LOC100255804 [Vitis vinifera] gi|302143427|emb|CBI21988.3| unnamed protein product [Vitis vinifera] Length = 817 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 81 LSHSEPNIANTFWRRSRRKVIAEQQTASS 167 LSHSEPNIA TFWRRSRRKVIAEQ+TASS Sbjct: 343 LSHSEPNIATTFWRRSRRKVIAEQRTASS 371 >ref|NP_180658.3| protein kinase domain-containing protein [Arabidopsis thaliana] gi|334184603|ref|NP_001189646.1| protein kinase domain-containing protein [Arabidopsis thaliana] gi|330253382|gb|AEC08476.1| protein kinase domain-containing protein [Arabidopsis thaliana] gi|330253383|gb|AEC08477.1| protein kinase domain-containing protein [Arabidopsis thaliana] Length = 775 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 2/55 (3%) Frame = +3 Query: 9 YP--SGTATAMLINSFHTNSGAELAGLSHSEPNIANTFWRRSRRKVIAEQQTASS 167 YP SG++ L+ T +L+ SHSEPN+A FWRRSRRKVIAEQ+TASS Sbjct: 306 YPNASGSSLRSLMLRPSTAIERKLSNTSHSEPNVATVFWRRSRRKVIAEQRTASS 360 >ref|XP_002528550.1| protein kinase, putative [Ricinus communis] gi|223532052|gb|EEF33862.1| protein kinase, putative [Ricinus communis] Length = 810 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 81 LSHSEPNIANTFWRRSRRKVIAEQQTASS 167 LSHSEPNIA TFWRRSR+KVIAEQ+TASS Sbjct: 342 LSHSEPNIATTFWRRSRKKVIAEQRTASS 370 >ref|XP_002321072.1| predicted protein [Populus trichocarpa] gi|222861845|gb|EEE99387.1| predicted protein [Populus trichocarpa] Length = 822 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 81 LSHSEPNIANTFWRRSRRKVIAEQQTASS 167 LSHSEPNIA TFWRRSR+KVIAEQ+TASS Sbjct: 343 LSHSEPNIATTFWRRSRKKVIAEQRTASS 371 >ref|XP_002879296.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297325135|gb|EFH55555.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 764 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 69 ELAGLSHSEPNIANTFWRRSRRKVIAEQQTASS 167 +L+ SHSEPN+A FWRRSRRKVIAEQ+TASS Sbjct: 318 KLSNTSHSEPNVATVFWRRSRRKVIAEQRTASS 350