BLASTX nr result
ID: Coptis25_contig00007328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00007328 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534291.1| PREDICTED: uncharacterized protein At1g32220... 64 1e-08 ref|NP_001242844.1| uncharacterized protein LOC100791538 [Glycin... 64 1e-08 ref|XP_002326745.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 gb|AFK41772.1| unknown [Lotus japonicus] 62 6e-08 gb|AFK34027.1| unknown [Lotus japonicus] 62 6e-08 >ref|XP_003534291.1| PREDICTED: uncharacterized protein At1g32220, chloroplastic-like [Glycine max] Length = 303 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -3 Query: 277 YNLPSFLLSSGYFTGKRKAEAEVLSKYPNSDLLV 176 YNLPSFLLSSGYFTGKRKAE+EVLSKYPNS +++ Sbjct: 181 YNLPSFLLSSGYFTGKRKAESEVLSKYPNSGIVL 214 >ref|NP_001242844.1| uncharacterized protein LOC100791538 [Glycine max] gi|255634634|gb|ACU17679.1| unknown [Glycine max] Length = 303 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -3 Query: 277 YNLPSFLLSSGYFTGKRKAEAEVLSKYPNSDLLV 176 YNLPSFLLSSGYFTGKRKAE+EVLSKYPNS +++ Sbjct: 181 YNLPSFLLSSGYFTGKRKAESEVLSKYPNSGIVL 214 >ref|XP_002326745.1| predicted protein [Populus trichocarpa] gi|222834067|gb|EEE72544.1| predicted protein [Populus trichocarpa] Length = 313 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 277 YNLPSFLLSSGYFTGKRKAEAEVLSKYPNSDLLV 176 YNLPSF+LS+GYFTGKRKAEAEVLSKYPNS +++ Sbjct: 191 YNLPSFVLSTGYFTGKRKAEAEVLSKYPNSGVVL 224 >gb|AFK41772.1| unknown [Lotus japonicus] Length = 154 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 277 YNLPSFLLSSGYFTGKRKAEAEVLSKYPNSDLLV 176 YNLPSFLLSSGYFTGKRKAE+EVLSKYP S +++ Sbjct: 32 YNLPSFLLSSGYFTGKRKAESEVLSKYPGSGIVL 65 >gb|AFK34027.1| unknown [Lotus japonicus] Length = 301 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 277 YNLPSFLLSSGYFTGKRKAEAEVLSKYPNSDLLV 176 YNLPSFLLSSGYFTGKRKAE+EVLSKYP S +++ Sbjct: 179 YNLPSFLLSSGYFTGKRKAESEVLSKYPGSGIVL 212