BLASTX nr result
ID: Coptis25_contig00007322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00007322 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFN06795.1| calcium-dependent protein kinase, partial [Vitis ... 59 5e-07 ref|XP_003632543.1| PREDICTED: calcium-dependent protein kinase ... 59 5e-07 emb|CBI27695.3| unnamed protein product [Vitis vinifera] 59 5e-07 gb|AAR28766.1| calcium-dependent protein kinase [Vitis labrusca ... 59 5e-07 ref|XP_002325726.1| calcium dependent protein kinase 12 [Populus... 55 8e-06 >gb|AFN06795.1| calcium-dependent protein kinase, partial [Vitis amurensis] Length = 497 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +1 Query: 1 DYGEFAAMMRKGNGGGVGRRTMRNNFNLDDVLKSSD 108 DYGEFAAMMRKGNGG +GRRTMRNN NL DVL D Sbjct: 458 DYGEFAAMMRKGNGG-IGRRTMRNNLNLGDVLGIPD 492 >ref|XP_003632543.1| PREDICTED: calcium-dependent protein kinase SK5-like [Vitis vinifera] Length = 540 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +1 Query: 1 DYGEFAAMMRKGNGGGVGRRTMRNNFNLDDVLKSSD 108 DYGEFAAMMRKGNGG +GRRTMRNN NL DVL D Sbjct: 501 DYGEFAAMMRKGNGG-IGRRTMRNNLNLGDVLGIPD 535 >emb|CBI27695.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +1 Query: 1 DYGEFAAMMRKGNGGGVGRRTMRNNFNLDDVLKSSD 108 DYGEFAAMMRKGNGG +GRRTMRNN NL DVL D Sbjct: 308 DYGEFAAMMRKGNGG-IGRRTMRNNLNLGDVLGIPD 342 >gb|AAR28766.1| calcium-dependent protein kinase [Vitis labrusca x Vitis vinifera] gi|147799573|emb|CAN70726.1| hypothetical protein VITISV_011381 [Vitis vinifera] Length = 497 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +1 Query: 1 DYGEFAAMMRKGNGGGVGRRTMRNNFNLDDVLKSSD 108 DYGEFAAMMRKGNGG +GRRTMRNN NL DVL D Sbjct: 458 DYGEFAAMMRKGNGG-IGRRTMRNNLNLGDVLGIPD 492 >ref|XP_002325726.1| calcium dependent protein kinase 12 [Populus trichocarpa] gi|222862601|gb|EEF00108.1| calcium dependent protein kinase 12 [Populus trichocarpa] Length = 503 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 1 DYGEFAAMMRKGNGGGVGRRTMRNNFNLDDVL 96 DYGEFAAMMRKGN GG+GRRTMR+ FNL D L Sbjct: 462 DYGEFAAMMRKGN-GGIGRRTMRSTFNLGDAL 492