BLASTX nr result
ID: Coptis25_contig00007103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00007103 (570 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002865926.1| predicted protein [Arabidopsis lyrata subsp.... 76 3e-12 ref|NP_568776.2| myb family transcription factor [Arabidopsis th... 76 4e-12 ref|XP_002320823.1| predicted protein [Populus trichocarpa] gi|2... 76 4e-12 ref|NP_851177.1| myb family transcription factor [Arabidopsis th... 76 4e-12 ref|XP_002273319.2| PREDICTED: transcription factor ASG4-like [V... 74 2e-11 >ref|XP_002865926.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297311761|gb|EFH42185.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 321 Score = 76.3 bits (186), Expect = 3e-12 Identities = 39/47 (82%), Positives = 41/47 (87%), Gaps = 1/47 (2%) Frame = -3 Query: 568 PIDVETVLLLMRNLSINLSSPDFEDHRRLLSSYDVDSE-KTEASGAN 431 PIDVETVLLLMRNLSINLSSPDFEDHRRLLSSYD+ SE T+ G N Sbjct: 273 PIDVETVLLLMRNLSINLSSPDFEDHRRLLSSYDIGSETATDRDGVN 319 >ref|NP_568776.2| myb family transcription factor [Arabidopsis thaliana] gi|25082907|gb|AAN72013.1| putative protein [Arabidopsis thaliana] gi|45357110|gb|AAS58514.1| MYB transcription factor [Arabidopsis thaliana] gi|108385408|gb|ABF85784.1| At5g52660 [Arabidopsis thaliana] gi|332008864|gb|AED96247.1| myb family transcription factor [Arabidopsis thaliana] Length = 331 Score = 75.9 bits (185), Expect = 4e-12 Identities = 39/47 (82%), Positives = 41/47 (87%), Gaps = 1/47 (2%) Frame = -3 Query: 568 PIDVETVLLLMRNLSINLSSPDFEDHRRLLSSYDVDSE-KTEASGAN 431 PIDVETVLLLMRNLSINLSSPDFEDHRRLLSSYD+ SE T+ G N Sbjct: 273 PIDVETVLLLMRNLSINLSSPDFEDHRRLLSSYDIGSETATDHGGVN 319 >ref|XP_002320823.1| predicted protein [Populus trichocarpa] gi|222861596|gb|EEE99138.1| predicted protein [Populus trichocarpa] Length = 356 Score = 75.9 bits (185), Expect = 4e-12 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -3 Query: 568 PIDVETVLLLMRNLSINLSSPDFEDHRRLLSSYDVDSEKTEASGA 434 PI++ETVLLLMRNLSINL+SP+FEDHRRLL+SYDVDSEK GA Sbjct: 296 PINLETVLLLMRNLSINLTSPEFEDHRRLLASYDVDSEKVNEGGA 340 >ref|NP_851177.1| myb family transcription factor [Arabidopsis thaliana] gi|21593278|gb|AAM65227.1| contains similarity to MYB-related DNA-binding protein [Arabidopsis thaliana] gi|62241826|emb|CAI77451.1| myb transcription factor LHY-CCA1-like2 [Arabidopsis thaliana] gi|332008863|gb|AED96246.1| myb family transcription factor [Arabidopsis thaliana] Length = 330 Score = 75.9 bits (185), Expect = 4e-12 Identities = 39/47 (82%), Positives = 41/47 (87%), Gaps = 1/47 (2%) Frame = -3 Query: 568 PIDVETVLLLMRNLSINLSSPDFEDHRRLLSSYDVDSE-KTEASGAN 431 PIDVETVLLLMRNLSINLSSPDFEDHRRLLSSYD+ SE T+ G N Sbjct: 272 PIDVETVLLLMRNLSINLSSPDFEDHRRLLSSYDIGSETATDHGGVN 318 >ref|XP_002273319.2| PREDICTED: transcription factor ASG4-like [Vitis vinifera] Length = 337 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -3 Query: 568 PIDVETVLLLMRNLSINLSSPDFEDHRRLLSSYDVDSEKTEASGANN 428 PIDVETVLLLMRNLSINL+SPDFEDHR+LLS+Y++DSE T +N Sbjct: 270 PIDVETVLLLMRNLSINLTSPDFEDHRKLLSTYEIDSETTSHGVESN 316