BLASTX nr result
ID: Coptis25_contig00006793
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00006793 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280247.1| PREDICTED: eukaryotic translation initiation... 91 1e-16 ref|XP_004156166.1| PREDICTED: eukaryotic translation initiation... 86 2e-15 ref|XP_004141468.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic t... 86 2e-15 gb|ABB29949.1| unknown [Solanum tuberosum] 86 3e-15 ref|XP_002533539.1| cop9 complex subunit 7a, putative [Ricinus c... 82 5e-14 >ref|XP_002280247.1| PREDICTED: eukaryotic translation initiation factor 3 subunit M [Vitis vinifera] gi|296082198|emb|CBI21203.3| unnamed protein product [Vitis vinifera] Length = 410 Score = 90.5 bits (223), Expect = 1e-16 Identities = 40/56 (71%), Positives = 48/56 (85%) Frame = -3 Query: 285 VIVSRCTERVFGMNQWQNLKSKLTTWRGNIANVRSTIEVNKVAEDASHGMQGLTVR 118 V+VSRC+ERVFG QWQNL+SKL TWRGNIANV +TI+ NK++ED S MQGLT+R Sbjct: 355 VLVSRCSERVFGQQQWQNLRSKLLTWRGNIANVINTIQANKISEDGSQAMQGLTIR 410 >ref|XP_004156166.1| PREDICTED: eukaryotic translation initiation factor 3 subunit M-like [Cucumis sativus] Length = 410 Score = 86.3 bits (212), Expect = 2e-15 Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = -3 Query: 285 VIVSRCTERVFGMNQWQNLKSKLTTWRGNIANVRSTIEVNKVAEDASHGMQGLTVR 118 VIVSRCT+RVFG +QW+ L++KLTTWRGNIANV TI NK+ ED S MQGL +R Sbjct: 355 VIVSRCTDRVFGQHQWETLRTKLTTWRGNIANVIGTIRANKIVEDGSQAMQGLAIR 410 >ref|XP_004141468.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation factor 3 subunit M-like [Cucumis sativus] Length = 417 Score = 86.3 bits (212), Expect = 2e-15 Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = -3 Query: 285 VIVSRCTERVFGMNQWQNLKSKLTTWRGNIANVRSTIEVNKVAEDASHGMQGLTVR 118 VIVSRCT+RVFG +QW+ L++KLTTWRGNIANV TI NK+ ED S MQGL +R Sbjct: 362 VIVSRCTDRVFGQHQWETLRTKLTTWRGNIANVIGTIRANKIVEDGSQAMQGLAIR 417 >gb|ABB29949.1| unknown [Solanum tuberosum] Length = 410 Score = 85.9 bits (211), Expect = 3e-15 Identities = 37/56 (66%), Positives = 47/56 (83%) Frame = -3 Query: 285 VIVSRCTERVFGMNQWQNLKSKLTTWRGNIANVRSTIEVNKVAEDASHGMQGLTVR 118 VIVSRCTERVFG++QWQ L++KL TWRGNIA V ST++ NK+ ED++ MQGL +R Sbjct: 355 VIVSRCTERVFGVHQWQELRTKLVTWRGNIAGVISTVQANKITEDSTQAMQGLAIR 410 >ref|XP_002533539.1| cop9 complex subunit 7a, putative [Ricinus communis] gi|223526589|gb|EEF28842.1| cop9 complex subunit 7a, putative [Ricinus communis] Length = 412 Score = 82.0 bits (201), Expect = 5e-14 Identities = 37/56 (66%), Positives = 43/56 (76%) Frame = -3 Query: 285 VIVSRCTERVFGMNQWQNLKSKLTTWRGNIANVRSTIEVNKVAEDASHGMQGLTVR 118 VIVS CTERVFG +QWQ L+SKL TWR N+ NV +TI+ NKV ED S MQGL +R Sbjct: 357 VIVSSCTERVFGQHQWQKLRSKLATWRDNVTNVINTIQANKVTEDGSQAMQGLMIR 412