BLASTX nr result
ID: Coptis25_contig00006784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00006784 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282506.1| PREDICTED: ubiquitin-associated domain-conta... 89 5e-16 gb|ABP98986.1| putative ubiquitin associated/TS-N domain-contain... 83 3e-14 ref|NP_191233.1| Ubiquitin-associated (UBA) protein [Arabidopsis... 82 3e-14 ref|XP_002307981.1| predicted protein [Populus trichocarpa] gi|2... 82 3e-14 ref|XP_002876380.1| ubiquitin-associated /TS-N domain-containing... 82 5e-14 >ref|XP_002282506.1| PREDICTED: ubiquitin-associated domain-containing protein 2 isoform 1 [Vitis vinifera] gi|297741648|emb|CBI32780.3| unnamed protein product [Vitis vinifera] Length = 294 Score = 88.6 bits (218), Expect = 5e-16 Identities = 46/82 (56%), Positives = 55/82 (67%), Gaps = 9/82 (10%) Frame = -2 Query: 219 LKFLFSSRKRSILPGICGVLASLLYHSNIFGIRHIKFPEFVSSFFSQLCWPTLGGSSPSA 40 L+ L SS KRSILPGICG+LA LY N F IR +KFPEF+SSFFS+L P G SS +A Sbjct: 161 LQLLLSSWKRSILPGICGILAGSLYRLNFFHIRKMKFPEFISSFFSRLSSPATGSSSTAA 220 Query: 39 SGRNVI---------EVEGNYP 1 RN++ +VEGNYP Sbjct: 221 PSRNILGNAPSYAGRQVEGNYP 242 >gb|ABP98986.1| putative ubiquitin associated/TS-N domain-containing protein [Hieracium piloselloides] Length = 289 Score = 82.8 bits (203), Expect = 3e-14 Identities = 39/77 (50%), Positives = 54/77 (70%), Gaps = 5/77 (6%) Frame = -2 Query: 219 LKFLFSSRKRSILPGICGVLASLLYHSNIFGIRHIKFPEFVSSFFSQLCWPTLGGSSPSA 40 L+ LFSS KRS++PG+CG+LA LY N+ IR +KFP+F++SFFS+L P++G +SP Sbjct: 161 LQLLFSSWKRSLIPGLCGILAGTLYRLNVLRIRRVKFPDFIASFFSRLSLPSVGSTSPVP 220 Query: 39 SGRN-----VIEVEGNY 4 RN +VEGNY Sbjct: 221 PARNAPSFAARQVEGNY 237 >ref|NP_191233.1| Ubiquitin-associated (UBA) protein [Arabidopsis thaliana] gi|9662993|emb|CAC00737.1| putative protein [Arabidopsis thaliana] gi|21553945|gb|AAM63026.1| unknown [Arabidopsis thaliana] gi|28950711|gb|AAO63279.1| At3g56740 [Arabidopsis thaliana] gi|110735889|dbj|BAE99920.1| hypothetical protein [Arabidopsis thaliana] gi|332646039|gb|AEE79560.1| Ubiquitin-associated (UBA) protein [Arabidopsis thaliana] Length = 293 Score = 82.4 bits (202), Expect = 3e-14 Identities = 38/66 (57%), Positives = 48/66 (72%) Frame = -2 Query: 219 LKFLFSSRKRSILPGICGVLASLLYHSNIFGIRHIKFPEFVSSFFSQLCWPTLGGSSPSA 40 ++ L SS KRSI PGICG++A LY NI GIR KFPEFV+SFFS+L +P+ G S P A Sbjct: 161 VQLLLSSWKRSIFPGICGIIAGSLYRLNILGIRKAKFPEFVASFFSRLSFPSFGNSPPPA 220 Query: 39 SGRNVI 22 RN++ Sbjct: 221 PSRNIV 226 >ref|XP_002307981.1| predicted protein [Populus trichocarpa] gi|222853957|gb|EEE91504.1| predicted protein [Populus trichocarpa] Length = 290 Score = 82.4 bits (202), Expect = 3e-14 Identities = 41/75 (54%), Positives = 52/75 (69%), Gaps = 11/75 (14%) Frame = -2 Query: 219 LKFLFSSRKRSILPGICGVLASLLYHSNIFGIRHIKFPEFVSSFFSQLCWPTLG------ 58 ++ L SS KRSILPGICG+LA LY N+FGIR KFPEF++SFFS+L WP+ G Sbjct: 161 VQLLLSSWKRSILPGICGILAGSLYRLNLFGIRKAKFPEFIASFFSRLSWPSTGSPRGAT 220 Query: 57 -----GSSPSASGRN 28 GS+PS +GR+ Sbjct: 221 SRNVTGSAPSYAGRH 235 >ref|XP_002876380.1| ubiquitin-associated /TS-N domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322218|gb|EFH52639.1| ubiquitin-associated /TS-N domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 293 Score = 82.0 bits (201), Expect = 5e-14 Identities = 38/66 (57%), Positives = 48/66 (72%) Frame = -2 Query: 219 LKFLFSSRKRSILPGICGVLASLLYHSNIFGIRHIKFPEFVSSFFSQLCWPTLGGSSPSA 40 ++ L SS KRSI PGICG++A LY NI GIR KFPEFV+SFFS+L +P+ G S P A Sbjct: 161 VQLLLSSWKRSIFPGICGIIAGPLYRLNILGIRKAKFPEFVASFFSRLSFPSFGNSPPPA 220 Query: 39 SGRNVI 22 RN++ Sbjct: 221 PSRNIV 226