BLASTX nr result
ID: Coptis25_contig00006609
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00006609 (572 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263397.2| PREDICTED: transcription factor PIF1-like [V... 83 4e-14 ref|XP_003541386.1| PREDICTED: transcription factor PIF1-like [G... 83 4e-14 ref|XP_003536955.1| PREDICTED: transcription factor PIF1-like [G... 83 4e-14 emb|CBI37249.3| unnamed protein product [Vitis vinifera] 83 4e-14 ref|XP_002521150.1| Phytochrome-interacting factor, putative [Ri... 82 8e-14 >ref|XP_002263397.2| PREDICTED: transcription factor PIF1-like [Vitis vinifera] Length = 517 Score = 82.8 bits (203), Expect = 4e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = -2 Query: 133 RHRDRINEKMKAL*ELIPRCNKSDKASMLDEAIEYLKSLQLQVQ 2 R RDRINEKMKAL ELIPRCNKSDKASMLDEAIEYLKSLQLQVQ Sbjct: 319 RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQ 362 >ref|XP_003541386.1| PREDICTED: transcription factor PIF1-like [Glycine max] Length = 476 Score = 82.8 bits (203), Expect = 4e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = -2 Query: 133 RHRDRINEKMKAL*ELIPRCNKSDKASMLDEAIEYLKSLQLQVQ 2 R RDRINEKMKAL ELIPRCNKSDKASMLDEAIEYLKSLQLQVQ Sbjct: 274 RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQ 317 >ref|XP_003536955.1| PREDICTED: transcription factor PIF1-like [Glycine max] Length = 491 Score = 82.8 bits (203), Expect = 4e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = -2 Query: 133 RHRDRINEKMKAL*ELIPRCNKSDKASMLDEAIEYLKSLQLQVQ 2 R RDRINEKMKAL ELIPRCNKSDKASMLDEAIEYLKSLQLQVQ Sbjct: 287 RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQ 330 >emb|CBI37249.3| unnamed protein product [Vitis vinifera] Length = 479 Score = 82.8 bits (203), Expect = 4e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = -2 Query: 133 RHRDRINEKMKAL*ELIPRCNKSDKASMLDEAIEYLKSLQLQVQ 2 R RDRINEKMKAL ELIPRCNKSDKASMLDEAIEYLKSLQLQVQ Sbjct: 281 RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQ 324 >ref|XP_002521150.1| Phytochrome-interacting factor, putative [Ricinus communis] gi|223539719|gb|EEF41301.1| Phytochrome-interacting factor, putative [Ricinus communis] Length = 572 Score = 81.6 bits (200), Expect = 8e-14 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -2 Query: 133 RHRDRINEKMKAL*ELIPRCNKSDKASMLDEAIEYLKSLQLQVQ 2 R RDRINEKM+AL ELIPRCNKSDKASMLDEAIEYLKSLQLQVQ Sbjct: 371 RRRDRINEKMRALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQ 414