BLASTX nr result
ID: Coptis25_contig00006280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00006280 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB67869.1| plasma membrane major intrinsic protein 2 [Beta v... 97 2e-18 dbj|BAD90701.1| plasma membrane intrinsic protein 2;5 [Mimosa pu... 97 2e-18 gb|AFH36336.1| aquaporin PIP2;1 [Quercus petraea] 96 2e-18 gb|ACR56614.1| plasma intrinsic protein 2;4 [Juglans regia] 96 2e-18 gb|ACB42440.1| aquaporin PIP2;3 [Gossypium hirsutum] 96 3e-18 >gb|AAB67869.1| plasma membrane major intrinsic protein 2 [Beta vulgaris] Length = 281 Score = 96.7 bits (239), Expect = 2e-18 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -1 Query: 281 KAWDEHWIFWVGPFVGALVAAAYHQYILRAAAIKALGSFRSNPTN 147 KAWD+HWIFWVGPFVGAL AAAYHQYILRAAAIKALGSFRSNPTN Sbjct: 237 KAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSNPTN 281 >dbj|BAD90701.1| plasma membrane intrinsic protein 2;5 [Mimosa pudica] Length = 281 Score = 96.7 bits (239), Expect = 2e-18 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -1 Query: 281 KAWDEHWIFWVGPFVGALVAAAYHQYILRAAAIKALGSFRSNPTN 147 KAWD+HWIFWVGPFVGAL AAAYHQYILRAAAIKALGSFRSNPTN Sbjct: 237 KAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSNPTN 281 >gb|AFH36336.1| aquaporin PIP2;1 [Quercus petraea] Length = 278 Score = 96.3 bits (238), Expect = 2e-18 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -1 Query: 281 KAWDEHWIFWVGPFVGALVAAAYHQYILRAAAIKALGSFRSNPTN 147 K WDEHWIFWVGPFVGAL AAAYHQYILRAAAIKALGSFRSNPTN Sbjct: 234 KVWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSNPTN 278 >gb|ACR56614.1| plasma intrinsic protein 2;4 [Juglans regia] Length = 280 Score = 96.3 bits (238), Expect = 2e-18 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -1 Query: 281 KAWDEHWIFWVGPFVGALVAAAYHQYILRAAAIKALGSFRSNPTN 147 K WDEHWIFWVGPFVGAL AAAYHQYILRAAAIKALGSFRSNPTN Sbjct: 236 KVWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSNPTN 280 >gb|ACB42440.1| aquaporin PIP2;3 [Gossypium hirsutum] Length = 278 Score = 95.9 bits (237), Expect = 3e-18 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -1 Query: 281 KAWDEHWIFWVGPFVGALVAAAYHQYILRAAAIKALGSFRSNPTN 147 KAWDEHWIFWVGPFVGAL AA YHQYILRAAAIKALGSFRSNPTN Sbjct: 234 KAWDEHWIFWVGPFVGALAAAIYHQYILRAAAIKALGSFRSNPTN 278