BLASTX nr result
ID: Coptis25_contig00006179
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00006179 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280378.2| PREDICTED: protein IQ-DOMAIN 32-like [Vitis ... 74 2e-11 emb|CBI19825.3| unnamed protein product [Vitis vinifera] 74 2e-11 ref|XP_003527664.1| PREDICTED: uncharacterized protein LOC100799... 67 2e-09 ref|XP_003523553.1| PREDICTED: protein IQ-DOMAIN 32-like [Glycin... 67 2e-09 ref|XP_002510501.1| hypothetical protein RCOM_1596950 [Ricinus c... 65 4e-09 >ref|XP_002280378.2| PREDICTED: protein IQ-DOMAIN 32-like [Vitis vinifera] Length = 605 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = +1 Query: 118 RSEGKGSIDKRGWSFRKKSTRHRVLSNTVTSEIPSSGNKENLESTSNEFHAQTECSV 288 R KG DKRGWSFRK+S RHRVLSNTV SEIPSSGNKE+ ES + F + ++ Sbjct: 14 RKSRKGYSDKRGWSFRKRSARHRVLSNTVVSEIPSSGNKESPESAAINFQTPVDSTI 70 >emb|CBI19825.3| unnamed protein product [Vitis vinifera] Length = 502 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = +1 Query: 118 RSEGKGSIDKRGWSFRKKSTRHRVLSNTVTSEIPSSGNKENLESTSNEFHAQTECSV 288 R KG DKRGWSFRK+S RHRVLSNTV SEIPSSGNKE+ ES + F + ++ Sbjct: 14 RKSRKGYSDKRGWSFRKRSARHRVLSNTVVSEIPSSGNKESPESAAINFQTPVDSTI 70 >ref|XP_003527664.1| PREDICTED: uncharacterized protein LOC100799424 [Glycine max] Length = 430 Score = 66.6 bits (161), Expect = 2e-09 Identities = 35/56 (62%), Positives = 39/56 (69%) Frame = +1 Query: 121 SEGKGSIDKRGWSFRKKSTRHRVLSNTVTSEIPSSGNKENLESTSNEFHAQTECSV 288 SE K S DKRGWSFRKKS RHRVLSNTV +E PSS NKE E ++ F E +V Sbjct: 27 SEIKESNDKRGWSFRKKSARHRVLSNTVIAEAPSSANKETSECSTFNFQPLPEPNV 82 >ref|XP_003523553.1| PREDICTED: protein IQ-DOMAIN 32-like [Glycine max] Length = 904 Score = 66.6 bits (161), Expect = 2e-09 Identities = 35/56 (62%), Positives = 39/56 (69%) Frame = +1 Query: 121 SEGKGSIDKRGWSFRKKSTRHRVLSNTVTSEIPSSGNKENLESTSNEFHAQTECSV 288 SE K S DKRGWSFRKKS RHRVLSNTV +E PSS NKE+ E + F E +V Sbjct: 27 SEIKESNDKRGWSFRKKSARHRVLSNTVIAEAPSSANKESSECNNFNFQPLPEPNV 82 >ref|XP_002510501.1| hypothetical protein RCOM_1596950 [Ricinus communis] gi|223551202|gb|EEF52688.1| hypothetical protein RCOM_1596950 [Ricinus communis] Length = 849 Score = 65.5 bits (158), Expect = 4e-09 Identities = 31/55 (56%), Positives = 38/55 (69%) Frame = +1 Query: 124 EGKGSIDKRGWSFRKKSTRHRVLSNTVTSEIPSSGNKENLESTSNEFHAQTECSV 288 E K S DKRGWSFRK+S RHRVLSNT+ +E P S NKE+ ES + F + +V Sbjct: 29 ENKSSSDKRGWSFRKRSARHRVLSNTIIAEAPYSANKESSESATLTFQSPDSSNV 83