BLASTX nr result
ID: Coptis25_contig00006126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00006126 (229 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI38170.3| unnamed protein product [Vitis vinifera] 65 6e-09 ref|XP_002264458.1| PREDICTED: uncharacterized protein LOC100264... 65 6e-09 ref|XP_002512885.1| conserved hypothetical protein [Ricinus comm... 62 4e-08 ref|XP_002300133.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_004140549.1| PREDICTED: uncharacterized protein LOC101220... 55 6e-06 >emb|CBI38170.3| unnamed protein product [Vitis vinifera] Length = 65 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +2 Query: 44 KGNAKKRLLRVWQNEAVLKACAEPPPSKNTASGAVVTAE 160 K NAKKRLLRVWQNEAVLK C+EPPPSK +A G VT E Sbjct: 24 KANAKKRLLRVWQNEAVLKVCSEPPPSKTSAPGTNVTGE 62 >ref|XP_002264458.1| PREDICTED: uncharacterized protein LOC100264285 [Vitis vinifera] Length = 75 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +2 Query: 44 KGNAKKRLLRVWQNEAVLKACAEPPPSKNTASGAVVTAE 160 K NAKKRLLRVWQNEAVLK C+EPPPSK +A G VT E Sbjct: 34 KANAKKRLLRVWQNEAVLKVCSEPPPSKTSAPGTNVTGE 72 >ref|XP_002512885.1| conserved hypothetical protein [Ricinus communis] gi|223547896|gb|EEF49388.1| conserved hypothetical protein [Ricinus communis] Length = 81 Score = 62.4 bits (150), Expect = 4e-08 Identities = 32/42 (76%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +2 Query: 44 KGNAKKRLLRVWQNEAVLKACAEPPPSKNTA-SGAVVTAENN 166 K NAKKRLLRVWQNEAVLKACAEPPPSK +A S A AE + Sbjct: 34 KANAKKRLLRVWQNEAVLKACAEPPPSKTSALSDATGVAEKD 75 >ref|XP_002300133.1| predicted protein [Populus trichocarpa] gi|222847391|gb|EEE84938.1| predicted protein [Populus trichocarpa] Length = 82 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 44 KGNAKKRLLRVWQNEAVLKACAEPPPSKNTASGA 145 K NAKKRLLRVWQNEAVLKAC++ PSK +A+GA Sbjct: 36 KANAKKRLLRVWQNEAVLKACSQSQPSKMSAAGA 69 >ref|XP_004140549.1| PREDICTED: uncharacterized protein LOC101220585 [Cucumis sativus] gi|449519856|ref|XP_004166950.1| PREDICTED: uncharacterized protein LOC101231766 [Cucumis sativus] Length = 74 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = +2 Query: 44 KGNAKKRLLRVWQNEAVLKACAEPPPSKNTASGAVVTAEN 163 K NAKKRL RVWQNEAVLKAC+EPPP K++ +N Sbjct: 34 KANAKKRLHRVWQNEAVLKACSEPPPPKSSGDNISQVEKN 73