BLASTX nr result
ID: Coptis25_contig00005704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00005704 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003550013.1| PREDICTED: spindle assembly checkpoint compo... 79 4e-13 ref|XP_002527831.1| Spindle assembly checkpoint component mad1, ... 76 3e-12 ref|XP_002331116.1| predicted protein [Populus trichocarpa] gi|2... 75 4e-12 ref|XP_003529697.1| PREDICTED: spindle assembly checkpoint compo... 75 7e-12 emb|CBI29639.3| unnamed protein product [Vitis vinifera] 74 1e-11 >ref|XP_003550013.1| PREDICTED: spindle assembly checkpoint component mad1-like [Glycine max] Length = 703 Score = 79.0 bits (193), Expect = 4e-13 Identities = 42/63 (66%), Positives = 48/63 (76%) Frame = +2 Query: 26 QCWHQKHETEKKLFTFSSPSNEANSTETLVLVKHLQEELRNYECEVQEARKLKSTHENNE 205 +C HQK E EKKL T S E STE+ VLVKHLQ+ELRNYE EV+EARKL S+HEN E Sbjct: 230 ECLHQKIEVEKKLSTLMS--QEVASTESNVLVKHLQQELRNYESEVREARKLSSSHENIE 287 Query: 206 LIK 214 L+K Sbjct: 288 LLK 290 >ref|XP_002527831.1| Spindle assembly checkpoint component mad1, putative [Ricinus communis] gi|223532755|gb|EEF34534.1| Spindle assembly checkpoint component mad1, putative [Ricinus communis] Length = 728 Score = 75.9 bits (185), Expect = 3e-12 Identities = 41/65 (63%), Positives = 50/65 (76%) Frame = +2 Query: 20 LLQCWHQKHETEKKLFTFSSPSNEANSTETLVLVKHLQEELRNYECEVQEARKLKSTHEN 199 L +C HQK E EKKL +F+ E +STE +LVKHLQEELRN E EV+EARKLKS++EN Sbjct: 249 LSECLHQKGELEKKLSSFAI--QEGSSTEGNILVKHLQEELRNCESEVREARKLKSSYEN 306 Query: 200 NELIK 214 EL+K Sbjct: 307 VELLK 311 >ref|XP_002331116.1| predicted protein [Populus trichocarpa] gi|222872844|gb|EEF09975.1| predicted protein [Populus trichocarpa] Length = 729 Score = 75.5 bits (184), Expect = 4e-12 Identities = 37/65 (56%), Positives = 52/65 (80%) Frame = +2 Query: 20 LLQCWHQKHETEKKLFTFSSPSNEANSTETLVLVKHLQEELRNYECEVQEARKLKSTHEN 199 L +C HQ+ E EKKL +F+ E +ST++ +LVKHLQEELRN+E EV+EARK++S+HE+ Sbjct: 244 LTECSHQRSELEKKLSSFTF--QEGSSTDSNILVKHLQEELRNFETEVREARKIRSSHES 301 Query: 200 NELIK 214 EL+K Sbjct: 302 IELLK 306 >ref|XP_003529697.1| PREDICTED: spindle assembly checkpoint component mad1-like [Glycine max] Length = 701 Score = 74.7 bits (182), Expect = 7e-12 Identities = 40/63 (63%), Positives = 47/63 (74%) Frame = +2 Query: 26 QCWHQKHETEKKLFTFSSPSNEANSTETLVLVKHLQEELRNYECEVQEARKLKSTHENNE 205 +C HQK E EKKL T E STE+ VLVKHLQ+ELRNYE V+EARKL+S+HEN E Sbjct: 228 ECLHQKIEVEKKLSTLMF--QEVASTESNVLVKHLQQELRNYESVVREARKLRSSHENVE 285 Query: 206 LIK 214 L+K Sbjct: 286 LLK 288 >emb|CBI29639.3| unnamed protein product [Vitis vinifera] Length = 441 Score = 73.9 bits (180), Expect = 1e-11 Identities = 40/65 (61%), Positives = 48/65 (73%) Frame = +2 Query: 20 LLQCWHQKHETEKKLFTFSSPSNEANSTETLVLVKHLQEELRNYECEVQEARKLKSTHEN 199 L +C HQK E EKKL + +S S E+ +LVKHLQEELRNY EV+EARKLKS+HEN Sbjct: 237 LNECLHQKSEAEKKLSSCTS-QEVTTSMESDILVKHLQEELRNYGFEVREARKLKSSHEN 295 Query: 200 NELIK 214 EL+K Sbjct: 296 IELLK 300