BLASTX nr result
ID: Coptis25_contig00005625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00005625 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510718.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002510718.1| conserved hypothetical protein [Ricinus communis] gi|223551419|gb|EEF52905.1| conserved hypothetical protein [Ricinus communis] Length = 865 Score = 55.8 bits (133), Expect = 3e-06 Identities = 35/102 (34%), Positives = 52/102 (50%) Frame = +1 Query: 22 AGEIAGKRNSSNQLLDELETLSQSIYQPXXXXXXXXXXXXLALPRDAVPTASSIDSIATA 201 A E + +RNS+ QLL+ELE LSQS+YQ LALPR +VP+ +S+D I+T+ Sbjct: 3 AAEYSNRRNSNTQLLEELEALSQSLYQ-THTTTTNRRTASLALPRTSVPSLASVDEISTS 61 Query: 202 KIEGTHEXXXXXXXXXXXXXXXXKLDDENEQNDRAKVSSRQE 327 K + D+NE +RA S++ + Sbjct: 62 KPDEKSTSRPRSRRMSLSPWRSRPKPDDNEPKNRAGPSNQPD 103