BLASTX nr result
ID: Coptis25_contig00005567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00005567 (583 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002262986.2| PREDICTED: proliferation-associated protein ... 55 9e-06 >ref|XP_002262986.2| PREDICTED: proliferation-associated protein 2G4-like [Vitis vinifera] gi|296081116|emb|CBI18248.3| unnamed protein product [Vitis vinifera] Length = 394 Score = 55.1 bits (131), Expect = 9e-06 Identities = 29/60 (48%), Positives = 32/60 (53%) Frame = -2 Query: 582 LQDLQPTKAVDDPEIKAWLALXXXXXXXXXXXXXXXKNSDKADEGGEVGSMDTTTNDMSE 403 LQ+LQPTK DDPEIKAWLAL K DK +E E MD TTN S+ Sbjct: 334 LQELQPTKTTDDPEIKAWLALGTKTKKKGGGKKKKGKKGDKPEESAEAEPMDATTNGASQ 393