BLASTX nr result
ID: Coptis25_contig00005475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00005475 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001185092.1| anthranilate synthase beta subunit 1 [Arabid... 56 3e-06 >ref|NP_001185092.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] gi|332192469|gb|AEE30590.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] Length = 289 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 95 FLVLKYMGELGCNFEVYRNDDLTVEELARKN 3 +L L+YMGELGC+FEVYRND+LTVEEL +KN Sbjct: 99 YLFLQYMGELGCHFEVYRNDELTVEELKKKN 129