BLASTX nr result
ID: Coptis25_contig00005472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00005472 (623 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531584.1| programmed cell death protein, putative [Ric... 58 2e-06 >ref|XP_002531584.1| programmed cell death protein, putative [Ricinus communis] gi|223528780|gb|EEF30787.1| programmed cell death protein, putative [Ricinus communis] Length = 1330 Score = 57.8 bits (138), Expect = 2e-06 Identities = 34/58 (58%), Positives = 40/58 (68%), Gaps = 5/58 (8%) Frame = -3 Query: 492 EFKCGVP*-GRSIFDNVLRDQ-KGTYLWSSYLDQEILLGDVDV---MFSRISIFCYPA 334 EFKCGVP GRS+F+ +LR+ K T LWS YLDQEI LGDVDV +F R + PA Sbjct: 1234 EFKCGVPDRGRSMFEGILREYPKRTDLWSVYLDQEIRLGDVDVTRTLFERATSLSLPA 1291