BLASTX nr result
ID: Coptis25_contig00004030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00004030 (341 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002869865.1| beta-glucosidase 47 [Arabidopsis lyrata subs... 72 5e-11 ref|XP_002979904.1| hypothetical protein SELMODRAFT_268319 [Sela... 72 6e-11 ref|XP_003541849.1| PREDICTED: beta-glucosidase 18-like [Glycine... 70 1e-10 ref|XP_002987383.1| hypothetical protein SELMODRAFT_235275 [Sela... 70 1e-10 ref|NP_193907.2| beta-glucosidase 47 [Arabidopsis thaliana] gi|2... 70 2e-10 >ref|XP_002869865.1| beta-glucosidase 47 [Arabidopsis lyrata subsp. lyrata] gi|297315701|gb|EFH46124.1| beta-glucosidase 47 [Arabidopsis lyrata subsp. lyrata] Length = 523 Score = 72.0 bits (175), Expect = 5e-11 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = +1 Query: 1 FAWSLLDTFELATGYTIRFGMYYVDFNTLERLPKTSSKWFKTFL 132 FAWSLLD FE +GYTIRFGMY+VDFNT ER P+ S+ W+K F+ Sbjct: 470 FAWSLLDNFEWISGYTIRFGMYHVDFNTQERTPRLSASWYKNFI 513 >ref|XP_002979904.1| hypothetical protein SELMODRAFT_268319 [Selaginella moellendorffii] gi|300152131|gb|EFJ18774.1| hypothetical protein SELMODRAFT_268319 [Selaginella moellendorffii] Length = 497 Score = 71.6 bits (174), Expect = 6e-11 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = +1 Query: 1 FAWSLLDTFELATGYTIRFGMYYVDFNTLERLPKTSSKWFKTFLNKT 141 FAWSL+D FE A GYT RFG+YYVD+ TL+R PK S++WFK FL+ + Sbjct: 446 FAWSLVDNFEWAMGYTKRFGLYYVDYETLKRYPKRSARWFKRFLSNS 492 >ref|XP_003541849.1| PREDICTED: beta-glucosidase 18-like [Glycine max] Length = 530 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +1 Query: 7 WSLLDTFELATGYTIRFGMYYVDFNTLERLPKTSSKWFKTFLNKT 141 WSL+D FE A+GY IRFG+YYVD TLER+PK S +WF +FLN T Sbjct: 460 WSLMDNFEWASGYDIRFGLYYVDRQTLERIPKLSVQWFSSFLNNT 504 >ref|XP_002987383.1| hypothetical protein SELMODRAFT_235275 [Selaginella moellendorffii] gi|300144789|gb|EFJ11470.1| hypothetical protein SELMODRAFT_235275 [Selaginella moellendorffii] Length = 465 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +1 Query: 1 FAWSLLDTFELATGYTIRFGMYYVDFNTLERLPKTSSKWFKTFLNKT 141 FAWSL+D FE A GYT RFG+YYVD+ TL+R PK S+ WFK FL+ + Sbjct: 414 FAWSLVDNFEWAMGYTKRFGLYYVDYETLKRYPKRSAHWFKRFLSNS 460 >ref|NP_193907.2| beta-glucosidase 47 [Arabidopsis thaliana] gi|281312217|sp|Q9SVS1.2|BGL47_ARATH RecName: Full=Beta-glucosidase 47; Short=AtBGLU47; Flags: Precursor gi|332659100|gb|AEE84500.1| beta-glucosidase 47 [Arabidopsis thaliana] Length = 535 Score = 70.1 bits (170), Expect = 2e-10 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +1 Query: 1 FAWSLLDTFELATGYTIRFGMYYVDFNTLERLPKTSSKWFKTFL 132 FAWSLLD FE +GYTIRFGMY+VDF+T ER P+ S+ W+K F+ Sbjct: 468 FAWSLLDNFEWISGYTIRFGMYHVDFSTQERTPRLSASWYKNFI 511