BLASTX nr result
ID: Coptis25_contig00003679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00003679 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM34788.1|AF512558_2 HAC5 [Arabidopsis thaliana] 106 2e-21 ref|NP_187904.1| histone acetyltransferase HAC5 [Arabidopsis tha... 106 2e-21 ref|XP_002882800.1| histone acetyltransferase 5 [Arabidopsis lyr... 106 2e-21 ref|NP_564706.1| histone acetyltransferase of the CBP family 4 [... 105 4e-21 ref|XP_002894548.1| histone acetyltransferase HAC4 [Arabidopsis ... 105 4e-21 >gb|AAM34788.1|AF512558_2 HAC5 [Arabidopsis thaliana] Length = 1012 Score = 106 bits (265), Expect = 2e-21 Identities = 45/65 (69%), Positives = 56/65 (86%) Frame = +2 Query: 71 VQTVNGKALRIFVCHEILIGYLGYCKK*GLSTCYIWTCPPMKGDNYVLYRHPEVQKAPNT 250 V+TV+G+ALR FV HEILIGYL YCKK G S+CYIW CPP+KG++Y+LY HPE+QK P T Sbjct: 666 VRTVSGEALRTFVYHEILIGYLDYCKKRGFSSCYIWACPPLKGEDYILYCHPEIQKTPKT 725 Query: 251 NKLRK 265 +KLR+ Sbjct: 726 DKLRE 730 >ref|NP_187904.1| histone acetyltransferase HAC5 [Arabidopsis thaliana] gi|75273168|sp|Q9LE42.1|HAC5_ARATH RecName: Full=Histone acetyltransferase HAC5 gi|15795129|dbj|BAB02507.1| CREB-binding protein-like [Arabidopsis thaliana] gi|332641749|gb|AEE75270.1| histone acetyltransferase HAC5 [Arabidopsis thaliana] Length = 1670 Score = 106 bits (265), Expect = 2e-21 Identities = 45/65 (69%), Positives = 56/65 (86%) Frame = +2 Query: 71 VQTVNGKALRIFVCHEILIGYLGYCKK*GLSTCYIWTCPPMKGDNYVLYRHPEVQKAPNT 250 V+TV+G+ALR FV HEILIGYL YCKK G S+CYIW CPP+KG++Y+LY HPE+QK P T Sbjct: 1194 VRTVSGEALRTFVYHEILIGYLDYCKKRGFSSCYIWACPPLKGEDYILYCHPEIQKTPKT 1253 Query: 251 NKLRK 265 +KLR+ Sbjct: 1254 DKLRE 1258 >ref|XP_002882800.1| histone acetyltransferase 5 [Arabidopsis lyrata subsp. lyrata] gi|297328640|gb|EFH59059.1| histone acetyltransferase 5 [Arabidopsis lyrata subsp. lyrata] Length = 1657 Score = 106 bits (265), Expect = 2e-21 Identities = 45/65 (69%), Positives = 56/65 (86%) Frame = +2 Query: 71 VQTVNGKALRIFVCHEILIGYLGYCKK*GLSTCYIWTCPPMKGDNYVLYRHPEVQKAPNT 250 V+TV+G+ALR FV HEILIGYL YCKK G S+CYIW CPP+KG++Y+LY HPE+QK P T Sbjct: 1181 VKTVSGEALRTFVYHEILIGYLDYCKKRGFSSCYIWACPPLKGEDYILYCHPEIQKTPKT 1240 Query: 251 NKLRK 265 +KLR+ Sbjct: 1241 DKLRE 1245 >ref|NP_564706.1| histone acetyltransferase of the CBP family 4 [Arabidopsis thaliana] gi|332195205|gb|AEE33326.1| histone acetyltransferase of the CBP family 4 [Arabidopsis thaliana] Length = 1456 Score = 105 bits (262), Expect = 4e-21 Identities = 44/64 (68%), Positives = 55/64 (85%) Frame = +2 Query: 74 QTVNGKALRIFVCHEILIGYLGYCKK*GLSTCYIWTCPPMKGDNYVLYRHPEVQKAPNTN 253 +TV+G+ALR FV HEILIGYL YCKK G ++CYIW CPP+KGD+Y+LY HPE+QK P T+ Sbjct: 976 RTVSGEALRTFVYHEILIGYLDYCKKRGFTSCYIWACPPLKGDDYILYCHPEIQKTPKTD 1035 Query: 254 KLRK 265 KLR+ Sbjct: 1036 KLRE 1039 >ref|XP_002894548.1| histone acetyltransferase HAC4 [Arabidopsis lyrata subsp. lyrata] gi|297340390|gb|EFH70807.1| histone acetyltransferase HAC4 [Arabidopsis lyrata subsp. lyrata] Length = 1563 Score = 105 bits (262), Expect = 4e-21 Identities = 44/65 (67%), Positives = 56/65 (86%) Frame = +2 Query: 71 VQTVNGKALRIFVCHEILIGYLGYCKK*GLSTCYIWTCPPMKGDNYVLYRHPEVQKAPNT 250 V+TV+G+ALR FV HEILIGYL YCKK G ++CYIW CPP+KG++Y+LY HPE+QK P T Sbjct: 1080 VRTVSGEALRTFVYHEILIGYLDYCKKRGFTSCYIWACPPLKGEDYILYCHPEIQKTPKT 1139 Query: 251 NKLRK 265 +KLR+ Sbjct: 1140 DKLRE 1144