BLASTX nr result
ID: Coptis25_contig00003667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00003667 (1068 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145505.1| PREDICTED: transcription initiation factor T... 102 2e-19 ref|XP_002324907.1| predicted protein [Populus trichocarpa] gi|2... 100 5e-19 ref|XP_002515435.1| protein with unknown function [Ricinus commu... 100 8e-19 ref|XP_003526182.1| PREDICTED: transcription initiation factor T... 99 2e-18 ref|XP_003563321.1| PREDICTED: transcription initiation factor T... 98 4e-18 >ref|XP_004145505.1| PREDICTED: transcription initiation factor TFIID subunit 5-like [Cucumis sativus] gi|449485181|ref|XP_004157092.1| PREDICTED: transcription initiation factor TFIID subunit 5-like [Cucumis sativus] Length = 674 Score = 102 bits (253), Expect = 2e-19 Identities = 52/66 (78%), Positives = 57/66 (86%), Gaps = 1/66 (1%) Frame = +2 Query: 140 LASGSADCTVKLWDVTASTKAPKLDE-KVGCTNRLRSLKTLPTKCSPVYTEQFSRRNLLF 316 LASGSADCTVKLWDVT+STK P+ DE K G NRLRSLKTLPTK +PVY+ +FSRRNLLF Sbjct: 603 LASGSADCTVKLWDVTSSTKPPRTDENKTGTPNRLRSLKTLPTKSTPVYSLRFSRRNLLF 662 Query: 317 AAGVLS 334 AAG LS Sbjct: 663 AAGALS 668 >ref|XP_002324907.1| predicted protein [Populus trichocarpa] gi|222866341|gb|EEF03472.1| predicted protein [Populus trichocarpa] Length = 675 Score = 100 bits (250), Expect = 5e-19 Identities = 52/66 (78%), Positives = 57/66 (86%), Gaps = 1/66 (1%) Frame = +2 Query: 140 LASGSADCTVKLWDVTASTKAPKLDE-KVGCTNRLRSLKTLPTKCSPVYTEQFSRRNLLF 316 LASGSADCTVKLWDVT STKAP+ +E K G TNRLR LKTLPTK +PVYT +FSRRNLLF Sbjct: 607 LASGSADCTVKLWDVTTSTKAPRTEESKSGNTNRLRLLKTLPTKSTPVYTLRFSRRNLLF 666 Query: 317 AAGVLS 334 AAG L+ Sbjct: 667 AAGALA 672 >ref|XP_002515435.1| protein with unknown function [Ricinus communis] gi|223545379|gb|EEF46884.1| protein with unknown function [Ricinus communis] Length = 670 Score = 100 bits (248), Expect = 8e-19 Identities = 52/66 (78%), Positives = 57/66 (86%), Gaps = 1/66 (1%) Frame = +2 Query: 140 LASGSADCTVKLWDVTASTKAPKLDE-KVGCTNRLRSLKTLPTKCSPVYTEQFSRRNLLF 316 LASGSADCTVKLWDVT+STK K +E K G NRLRSLKTLPTK +PVY+ +FSRRNLLF Sbjct: 602 LASGSADCTVKLWDVTSSTKVTKAEESKSGSANRLRSLKTLPTKSTPVYSLRFSRRNLLF 661 Query: 317 AAGVLS 334 AAGVLS Sbjct: 662 AAGVLS 667 >ref|XP_003526182.1| PREDICTED: transcription initiation factor TFIID subunit 5-like [Glycine max] Length = 663 Score = 98.6 bits (244), Expect = 2e-18 Identities = 48/65 (73%), Positives = 54/65 (83%) Frame = +2 Query: 140 LASGSADCTVKLWDVTASTKAPKLDEKVGCTNRLRSLKTLPTKCSPVYTEQFSRRNLLFA 319 +ASGSADCTVKLWDV STK + +EK G NRLRSLKTLPTK +PVY+ +FSRRNLLFA Sbjct: 596 IASGSADCTVKLWDVNTSTKVSRAEEKGGSANRLRSLKTLPTKSTPVYSLRFSRRNLLFA 655 Query: 320 AGVLS 334 AG LS Sbjct: 656 AGALS 660 >ref|XP_003563321.1| PREDICTED: transcription initiation factor TFIID subunit 5-like [Brachypodium distachyon] Length = 682 Score = 97.8 bits (242), Expect = 4e-18 Identities = 52/66 (78%), Positives = 55/66 (83%), Gaps = 1/66 (1%) Frame = +2 Query: 140 LASGSADCTVKLWDVTASTKAPKLDE-KVGCTNRLRSLKTLPTKCSPVYTEQFSRRNLLF 316 LASGSADCTVKLWDV +STKA KLD+ K G TNRLR LK LPTK SPVY +FSRRNLLF Sbjct: 614 LASGSADCTVKLWDVASSTKALKLDDTKGGSTNRLRLLKALPTKSSPVYNLRFSRRNLLF 673 Query: 317 AAGVLS 334 AAG LS Sbjct: 674 AAGALS 679