BLASTX nr result
ID: Coptis25_contig00003666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00003666 (781 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145505.1| PREDICTED: transcription initiation factor T... 92 1e-16 ref|XP_002324907.1| predicted protein [Populus trichocarpa] gi|2... 92 1e-16 ref|XP_002515435.1| protein with unknown function [Ricinus commu... 90 5e-16 ref|XP_003526182.1| PREDICTED: transcription initiation factor T... 89 8e-16 ref|XP_003563321.1| PREDICTED: transcription initiation factor T... 87 4e-15 >ref|XP_004145505.1| PREDICTED: transcription initiation factor TFIID subunit 5-like [Cucumis sativus] gi|449485181|ref|XP_004157092.1| PREDICTED: transcription initiation factor TFIID subunit 5-like [Cucumis sativus] Length = 674 Score = 92.0 bits (227), Expect = 1e-16 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 1/59 (1%) Frame = +1 Query: 316 DCTVKLWDVTASTKAPKMDE-KVGCTNRLRSLKTLPTKCSPVYTVQFSRRNLLFAAGVL 489 DCTVKLWDVT+STK P+ DE K G NRLRSLKTLPTK +PVY+++FSRRNLLFAAG L Sbjct: 609 DCTVKLWDVTSSTKPPRTDENKTGTPNRLRSLKTLPTKSTPVYSLRFSRRNLLFAAGAL 667 >ref|XP_002324907.1| predicted protein [Populus trichocarpa] gi|222866341|gb|EEF03472.1| predicted protein [Populus trichocarpa] Length = 675 Score = 92.0 bits (227), Expect = 1e-16 Identities = 46/59 (77%), Positives = 51/59 (86%), Gaps = 1/59 (1%) Frame = +1 Query: 316 DCTVKLWDVTASTKAPKMDE-KVGCTNRLRSLKTLPTKCSPVYTVQFSRRNLLFAAGVL 489 DCTVKLWDVT STKAP+ +E K G TNRLR LKTLPTK +PVYT++FSRRNLLFAAG L Sbjct: 613 DCTVKLWDVTTSTKAPRTEESKSGNTNRLRLLKTLPTKSTPVYTLRFSRRNLLFAAGAL 671 >ref|XP_002515435.1| protein with unknown function [Ricinus communis] gi|223545379|gb|EEF46884.1| protein with unknown function [Ricinus communis] Length = 670 Score = 90.1 bits (222), Expect = 5e-16 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 1/59 (1%) Frame = +1 Query: 316 DCTVKLWDVTASTKAPKMDE-KVGCTNRLRSLKTLPTKCSPVYTVQFSRRNLLFAAGVL 489 DCTVKLWDVT+STK K +E K G NRLRSLKTLPTK +PVY+++FSRRNLLFAAGVL Sbjct: 608 DCTVKLWDVTSSTKVTKAEESKSGSANRLRSLKTLPTKSTPVYSLRFSRRNLLFAAGVL 666 >ref|XP_003526182.1| PREDICTED: transcription initiation factor TFIID subunit 5-like [Glycine max] Length = 663 Score = 89.4 bits (220), Expect = 8e-16 Identities = 42/58 (72%), Positives = 48/58 (82%) Frame = +1 Query: 316 DCTVKLWDVTASTKAPKMDEKVGCTNRLRSLKTLPTKCSPVYTVQFSRRNLLFAAGVL 489 DCTVKLWDV STK + +EK G NRLRSLKTLPTK +PVY+++FSRRNLLFAAG L Sbjct: 602 DCTVKLWDVNTSTKVSRAEEKGGSANRLRSLKTLPTKSTPVYSLRFSRRNLLFAAGAL 659 >ref|XP_003563321.1| PREDICTED: transcription initiation factor TFIID subunit 5-like [Brachypodium distachyon] Length = 682 Score = 87.0 bits (214), Expect = 4e-15 Identities = 44/59 (74%), Positives = 49/59 (83%), Gaps = 1/59 (1%) Frame = +1 Query: 316 DCTVKLWDVTASTKAPKMDE-KVGCTNRLRSLKTLPTKCSPVYTVQFSRRNLLFAAGVL 489 DCTVKLWDV +STKA K+D+ K G TNRLR LK LPTK SPVY ++FSRRNLLFAAG L Sbjct: 620 DCTVKLWDVASSTKALKLDDTKGGSTNRLRLLKALPTKSSPVYNLRFSRRNLLFAAGAL 678